| Cool.Flash.Games/Games/1 screen hero.swf |
12.7 MB |
| Cool.Flash.Games/Games/10 Bullets.swf |
2.6 MB |
| Cool.Flash.Games/Games/10morebullets.swf |
5.2 MB |
| Cool.Flash.Games/Games/13 Days in Hell.swf |
4.8 MB |
| Cool.Flash.Games/Games/13_more_days_in_hell.swf |
5.6 MB |
| Cool.Flash.Games/Games/13daysafter.swf |
9.4 MB |
| Cool.Flash.Games/Games/13worms.swf |
2.5 MB |
| Cool.Flash.Games/Games/2012shelter.swf |
2.3 MB |
| Cool.Flash.Games/Games/2112_cooperation_series/2112_cooperation_chapter_1.swf |
8.2 MB |
| Cool.Flash.Games/Games/2112_cooperation_series/2112_cooperation_chapter_2.swf |
5.8 MB |
| Cool.Flash.Games/Games/2112_cooperation_series/2112_cooperation_chapter_3.swf |
8.1 MB |
| Cool.Flash.Games/Games/2112_cooperation_series/2112_cooperation_chapter_4.swf |
6.3 MB |
| Cool.Flash.Games/Games/2112_cooperation_series/2112_cooperation_chapter_5.swf |
9.6 MB |
| Cool.Flash.Games/Games/3 Pandas Series/3 Pandas 2. Night.swf |
8.5 MB |
| Cool.Flash.Games/Games/3 Pandas Series/3 Pandas in Brazil.swf |
12.2 MB |
| Cool.Flash.Games/Games/3 Pandas Series/3 Pandas in Fantasy.swf |
11.7 MB |
| Cool.Flash.Games/Games/3 Pandas Series/3 Pandas in Japan.swf |
9.6 MB |
| Cool.Flash.Games/Games/3 Pandas Series/3 Pandas.swf |
7.3 MB |
| Cool.Flash.Games/Games/300milestopigsland.swf |
6.3 MB |
| Cool.Flash.Games/Games/3lindgame.swf |
7.6 MB |
| Cool.Flash.Games/Games/4 differences.swf |
5.5 MB |
| Cool.Flash.Games/Games/400_years.swf |
4.5 MB |
| Cool.Flash.Games/Games/40xEscape.swf |
1.5 MB |
| Cool.Flash.Games/Games/5 Differences.swf |
1.4 MB |
| Cool.Flash.Games/Games/6 Differences.swf |
6.6 MB |
| Cool.Flash.Games/Games/60 seconds Santa Run.swf |
2 MB |
| Cool.Flash.Games/Games/60s to Save the Queen.swf |
3.1 MB |
| Cool.Flash.Games/Games/99 Bricks the Legend of Garry.swf |
4 MB |
| Cool.Flash.Games/Games/a duck has an adventure.swf |
562 KB |
| Cool.Flash.Games/Games/A Game About Game Literacy.swf |
6.8 MB |
| Cool.Flash.Games/Games/A Ghostly Journey.swf |
3.4 MB |
| Cool.Flash.Games/Games/A House in California.swf |
11.3 MB |
| Cool.Flash.Games/Games/A Kitty Dream.swf |
9 MB |
| Cool.Flash.Games/Games/a rabbit fable.swf |
16.6 MB |
| Cool.Flash.Games/Games/A small talk at the back of beyond.swf |
4.7 MB |
| Cool.Flash.Games/Games/A Stroll in Space.swf |
5.2 MB |
| Cool.Flash.Games/Games/a Trashy Love Story.swf |
4.3 MB |
| Cool.Flash.Games/Games/a_goody_life.swf |
5.1 MB |
| Cool.Flash.Games/Games/a_night_in_crazyville.swf |
4.4 MB |
| Cool.Flash.Games/Games/a_second_chance.swf |
3.7 MB |
| Cool.Flash.Games/Games/a_weekend_at_tweety_s.swf |
14.7 MB |
| Cool.Flash.Games/Games/abducted.swf |
1.8 MB |
| Cool.Flash.Games/Games/abduction.swf |
6.8 MB |
| Cool.Flash.Games/Games/abobosbigadventure.swf |
14 MB |
| Cool.Flash.Games/Games/aboveaverageguy.swf |
7.8 MB |
| Cool.Flash.Games/Games/abovehell.swf |
2.5 MB |
| Cool.Flash.Games/Games/absorbed.swf |
3.4 MB |
| Cool.Flash.Games/Games/absorbed_2.swf |
4.1 MB |
| Cool.Flash.Games/Games/abubathealien.swf |
4.3 MB |
| Cool.Flash.Games/Games/accurate_slapshot.swf |
1.6 MB |
| Cool.Flash.Games/Games/accurate_slapshot_level_pack.swf |
1.7 MB |
| Cool.Flash.Games/Games/accurateboy.swf |
6.1 MB |
| Cool.Flash.Games/Games/Achilles II Origin of a Legend.swf |
7.4 MB |
| Cool.Flash.Games/Games/Achilles.swf |
1.7 MB |
| Cool.Flash.Games/Games/acornstory.swf |
4.2 MB |
| Cool.Flash.Games/Games/adagio.swf |
3.1 MB |
| Cool.Flash.Games/Games/Adam and Eve.swf |
8.5 MB |
| Cool.Flash.Games/Games/adam_and_eve_2.swf |
2.6 MB |
| Cool.Flash.Games/Games/adam_and_eve_3.swf |
2.6 MB |
| Cool.Flash.Games/Games/adralienday.swf |
3.1 MB |
| Cool.Flash.Games/Games/Adventure Al.swf |
2 MB |
| Cool.Flash.Games/Games/Adventure Story.swf |
6.3 MB |
| Cool.Flash.Games/Games/adventure_time_-_jumping_finn.swf |
6.5 MB |
| Cool.Flash.Games/Games/adventuresofvalentin.swf |
7.3 MB |
| Cool.Flash.Games/Games/adventuresofveronicawright.swf |
2.1 MB |
| Cool.Flash.Games/Games/Adventurous Eric.swf |
1.9 MB |
| Cool.Flash.Games/Games/Aequilibrium Series/Aequilibrium 4.swf |
958 KB |
| Cool.Flash.Games/Games/Aequilibrium Series/Aequilibrium.swf |
1.2 MB |
| Cool.Flash.Games/Games/Aequilibrium Series/Aequilibrium2.swf |
759 KB |
| Cool.Flash.Games/Games/Aequilibrium Series/aequilibrium3.swf |
784 KB |
| Cool.Flash.Games/Games/aerorumble.swf |
2.8 MB |
| Cool.Flash.Games/Games/Aether.swf |
6.9 MB |
| Cool.Flash.Games/Games/aetherpunk.swf |
4.3 MB |
| Cool.Flash.Games/Games/afterglow.swf |
2.4 MB |
| Cool.Flash.Games/Games/Age of Wonder - The Lost Scrolls.swf |
6.1 MB |
| Cool.Flash.Games/Games/agent-b10-2.swf |
1.2 MB |
| Cool.Flash.Games/Games/agent-b10.swf |
1.1 MB |
| Cool.Flash.Games/Games/agentb10 3.swf |
3.2 MB |
| Cool.Flash.Games/Games/agentturnright.swf |
1.5 MB |
| Cool.Flash.Games/Games/ageofwonder.swf |
3.3 MB |
| Cool.Flash.Games/Games/aggro.swf |
5 MB |
| Cool.Flash.Games/Games/air_pressure.swf |
2.4 MB |
| Cool.Flash.Games/Games/air_transporter.swf |
4.5 MB |
| Cool.Flash.Games/Games/airbattle.swf |
1.9 MB |
| Cool.Flash.Games/Games/airbattle2.swf |
4.2 MB |
| Cool.Flash.Games/Games/airbornewars.swf |
2.4 MB |
| Cool.Flash.Games/Games/airbornewars2.swf |
2.7 MB |
| Cool.Flash.Games/Games/AL Project.swf |
18.9 MB |
| Cool.Flash.Games/Games/alaskan-adversary.swf |
6.1 MB |
| Cool.Flash.Games/Games/albertthealien.swf |
1012 KB |
| Cool.Flash.Games/Games/Alice is dead 2.swf |
6.1 MB |
| Cool.Flash.Games/Games/Alice is dead 3.swf |
9.6 MB |
| Cool.Flash.Games/Games/Alice is dead.swf |
3.1 MB |
| Cool.Flash.Games/Games/Alien Anarchy.swf |
9.4 MB |
| Cool.Flash.Games/Games/Alien Exterminator.swf |
1.2 MB |
| Cool.Flash.Games/Games/alien hominid.swf |
1.9 MB |
| Cool.Flash.Games/Games/alien_transporter.swf |
6.2 MB |
| Cool.Flash.Games/Games/alienbottlebuccaneer.swf |
2.1 MB |
| Cool.Flash.Games/Games/alienfamily.swf |
1.2 MB |
| Cool.Flash.Games/Games/alienhominidxtreme.swf |
6.1 MB |
| Cool.Flash.Games/Games/alienocalypse.swf |
4.8 MB |
| Cool.Flash.Games/Games/alienskidnappedbetty.swf |
1 MB |
| Cool.Flash.Games/Games/all that matters.swf |
4 MB |
| Cool.Flash.Games/Games/allweneedisbrain.swf |
3.8 MB |
| Cool.Flash.Games/Games/allweneedisbrain2.swf |
5.2 MB |
| Cool.Flash.Games/Games/allweneedisbrainlevelpack.swf |
6.1 MB |
| Cool.Flash.Games/Games/alphaland.swf |
4.8 MB |
| Cool.Flash.Games/Games/amea.swf |
14.8 MB |
| Cool.Flash.Games/Games/Amigo Pancho Series/Amigo Pancho 2 New York Party.swf |
4.9 MB |
| Cool.Flash.Games/Games/Amigo Pancho Series/Amigo Pancho 3 Sheriff Sancho.swf |
9.7 MB |
| Cool.Flash.Games/Games/Amigo Pancho Series/Amigo Pancho 4.swf |
8.5 MB |
| Cool.Flash.Games/Games/Amigo Pancho Series/Amigo Pancho 5_ Arctic and Peru.swf |
11.4 MB |
| Cool.Flash.Games/Games/Amigo Pancho Series/Amigo Pancho 6.swf |
8.7 MB |
| Cool.Flash.Games/Games/Amigo Pancho Series/Amigo Pancho 7.swf |
7.5 MB |
| Cool.Flash.Games/Games/Amigo Pancho Series/Amigo Pancho Death Star.swf |
7.7 MB |
| Cool.Flash.Games/Games/Amigo Pancho Series/Amigo Pancho.swf |
5.7 MB |
| Cool.Flash.Games/Games/Amil.swf |
6.2 MB |
| Cool.Flash.Games/Games/Anaksha Female Assassin.swf |
8.8 MB |
| Cool.Flash.Games/Games/anbot.swf |
2.2 MB |
| Cool.Flash.Games/Games/anbot2.swf |
2.5 MB |
| Cool.Flash.Games/Games/And Everything Started to Fall.swf |
525 KB |
| Cool.Flash.Games/Games/Andrew the Droid.swf |
1.4 MB |
| Cool.Flash.Games/Games/android.swf |
3.6 MB |
| Cool.Flash.Games/Games/angelofthebattlefield.swf |
1.8 MB |
| Cool.Flash.Games/Games/angelofthebattlefield2.swf |
3.1 MB |
| Cool.Flash.Games/Games/angrybee.swf |
1.8 MB |
| Cool.Flash.Games/Games/angrychubby.swf |
3.7 MB |
| Cool.Flash.Games/Games/anika_s_odyssey.swf |
3.4 MB |
| Cool.Flash.Games/Games/animaloffice.swf |
3.4 MB |
| Cool.Flash.Games/Games/Anniversary Game.swf |
4 MB |
| Cool.Flash.Games/Games/anti_terrorist rush.swf |
5.5 MB |
| Cool.Flash.Games/Games/anti_terrorist_rush_2.swf |
2.9 MB |
| Cool.Flash.Games/Games/Antichromatic.swf |
3.1 MB |
| Cool.Flash.Games/Games/Aqua Boy.swf |
7.9 MB |
| Cool.Flash.Games/Games/arcalona.swf |
12.6 MB |
| Cool.Flash.Games/Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 1.swf |
1.5 MB |
| Cool.Flash.Games/Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 2.swf |
1.5 MB |
| Cool.Flash.Games/Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 3.swf |
1.5 MB |
| Cool.Flash.Games/Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 4.swf |
1.8 MB |
| Cool.Flash.Games/Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 5.swf |
1.4 MB |
| Cool.Flash.Games/Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 6.swf |
1.9 MB |
| Cool.Flash.Games/Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 7.swf |
1.9 MB |
| Cool.Flash.Games/Games/Arcane The Stone Circle Series/Arcane The Stone Circle - Episode 8.swf |
2.7 MB |
| Cool.Flash.Games/Games/Arcane_Weapon.swf |
5.2 MB |
| Cool.Flash.Games/Games/archersoath.swf |
2.7 MB |
| Cool.Flash.Games/Games/arcs.swf |
2.9 MB |
| Cool.Flash.Games/Games/arcuz_behind_the_dark.swf |
13.6 MB |
| Cool.Flash.Games/Games/arcuz_ii_dungeons.swf |
30.9 MB |
| Cool.Flash.Games/Games/arm_of_revenge.swf |
19.9 MB |
| Cool.Flash.Games/Games/Armed With Wings Series/armed-with-wings.swf |
8 MB |
| Cool.Flash.Games/Games/Armed With Wings Series/armed_with_wings_-_culmination.swf |
8.6 MB |
| Cool.Flash.Games/Games/Armed With Wings Series/armed_with_wings_2.swf |
9.1 MB |
| Cool.Flash.Games/Games/Armed With Wings Series/armed_with_wings_3.swf |
19.6 MB |
| Cool.Flash.Games/Games/armor mayhem.swf |
9.7 MB |
| Cool.Flash.Games/Games/Armor_Defence.swf |
2.3 MB |
| Cool.Flash.Games/Games/armored_warfare_1917.swf |
14.7 MB |
| Cool.Flash.Games/Games/army_of_ages.swf |
10.5 MB |
| Cool.Flash.Games/Games/Arsenal 2 Romanov Files.swf |
8.8 MB |
| Cool.Flash.Games/Games/Arsenal.swf |
6.8 MB |
| Cool.Flash.Games/Games/art_of_war_omaha.swf |
9.5 MB |
| Cool.Flash.Games/Games/As I Lay Dying!.swf |
5.2 MB |
| Cool.Flash.Games/Games/asgard_skill_master.swf |
17.7 MB |
| Cool.Flash.Games/Games/asgard_story.swf |
11.7 MB |
| Cool.Flash.Games/Games/asleep walking.swf |
2.3 MB |
| Cool.Flash.Games/Games/assembots.swf |
2.6 MB |
| Cool.Flash.Games/Games/Astro Teemo.swf |
14.7 MB |
| Cool.Flash.Games/Games/astrocreep.swf |
30.8 MB |
| Cool.Flash.Games/Games/atomicpuzzle.swf |
4 MB |
| Cool.Flash.Games/Games/atomicpuzzle2.swf |
3.6 MB |
| Cool.Flash.Games/Games/attack_of_the_johnnies.swf |
13.8 MB |
| Cool.Flash.Games/Games/aurora.swf |
6 MB |
| Cool.Flash.Games/Games/aurora2.swf |
7.1 MB |
| Cool.Flash.Games/Games/automaton.swf |
2.9 MB |
| Cool.Flash.Games/Games/Avant-Garde.swf |
5.3 MB |
| Cool.Flash.Games/Games/avatar_elemental_escape.swf |
2 MB |
| Cool.Flash.Games/Games/avengers_global_chaos.swf |
7.3 MB |
| Cool.Flash.Games/Games/Awesome Conquest.swf |
5.1 MB |
| Cool.Flash.Games/Games/Awesome Seaquest.swf |
5.6 MB |
| Cool.Flash.Games/Games/awesome_happy_heroes.swf |
2.1 MB |
| Cool.Flash.Games/Games/awesome_happy_monster.swf |
7 MB |
| Cool.Flash.Games/Games/Awesome_Pirates.swf |
6.8 MB |
| Cool.Flash.Games/Games/awesome_run.swf |
6.3 MB |
| Cool.Flash.Games/Games/awesome_run_2.swf |
7.1 MB |
| Cool.Flash.Games/Games/awesome_tanks.swf |
5.5 MB |
| Cool.Flash.Games/Games/awesome_tanks_2.swf |
7 MB |
| Cool.Flash.Games/Games/awesomecars.swf |
5.6 MB |
| Cool.Flash.Games/Games/awesomeplanes.swf |
6.6 MB |
| Cool.Flash.Games/Games/baberescue.swf |
7.2 MB |
| Cool.Flash.Games/Games/babylon.swf |
7.4 MB |
| Cool.Flash.Games/Games/Back Door Series/back door 3 - the train.swf |
34.8 MB |
| Cool.Flash.Games/Games/Back Door Series/back_door-_door_1_the_call.swf |
12.1 MB |
| Cool.Flash.Games/Games/Back Door Series/back_door-_door_2_the_job.swf |
23.8 MB |
| Cool.Flash.Games/Games/Back in Time 2.swf |
5.3 MB |
| Cool.Flash.Games/Games/Back in Time.swf |
3.6 MB |
| Cool.Flash.Games/Games/Back to Zombieland.swf |
7.1 MB |
| Cool.Flash.Games/Games/Bad Viking and the Curse of the Mushroom King.swf |
7.9 MB |
| Cool.Flash.Games/Games/Ballooner New Adventures.swf |
1.1 MB |
| Cool.Flash.Games/Games/Ballooner.swf |
1.1 MB |
| Cool.Flash.Games/Games/balloons_vs_zombies.swf |
4.4 MB |
| Cool.Flash.Games/Games/Balls in Space.swf |
3.3 MB |
| Cool.Flash.Games/Games/ballsoflife.swf |
2.6 MB |
| Cool.Flash.Games/Games/bamboodino.swf |
2.2 MB |
| Cool.Flash.Games/Games/Band Of Heroes.swf |
12.2 MB |
| Cool.Flash.Games/Games/band_of_heroes_might_and_pillage.swf |
11.5 MB |
| Cool.Flash.Games/Games/baron_s_door.swf |
7.7 MB |
| Cool.Flash.Games/Games/Barons_Gate.swf |
6 MB |
| Cool.Flash.Games/Games/baronsgate2.swf |
8.7 MB |
| Cool.Flash.Games/Games/Bat Country.swf |
3.3 MB |
| Cool.Flash.Games/Games/Battalion Ghosts.swf |
4.9 MB |
| Cool.Flash.Games/Games/Battalion Skirmish.swf |
4.3 MB |
| Cool.Flash.Games/Games/Battalion Vengeance.swf |
5 MB |
| Cool.Flash.Games/Games/battalion_commander.swf |
4.2 MB |
| Cool.Flash.Games/Games/Battle of Britain 303 Squadron.swf |
19.5 MB |
| Cool.Flash.Games/Games/Battle Of Heroes.swf |
16.2 MB |
| Cool.Flash.Games/Games/Battle Sails.swf |
7.8 MB |
| Cool.Flash.Games/Games/battle_cry_-_ashes_of_berhyte.swf |
16.9 MB |
| Cool.Flash.Games/Games/battle_golf.swf |
4.5 MB |
| Cool.Flash.Games/Games/battle_stance_human_campaign.swf |
7 MB |
| Cool.Flash.Games/Games/battlecry.swf |
13.4 MB |
| Cool.Flash.Games/Games/battleforwaylandkeep.swf |
18.5 MB |
| Cool.Flash.Games/Games/battleofundermountain.swf |
3.8 MB |
| Cool.Flash.Games/Games/battlepanic.swf |
10 MB |
| Cool.Flash.Games/Games/Bazooka Boy Series/Bazooka Boy 3.swf |
8.2 MB |
| Cool.Flash.Games/Games/Bazooka Boy Series/Bazooka Boy Level Pack.swf |
600 KB |
| Cool.Flash.Games/Games/Bazooka Boy Series/Bazooka Boy.swf |
601 KB |
| Cool.Flash.Games/Games/Bazooka Boy Series/bazookaboy2.swf |
6.1 MB |
| Cool.Flash.Games/Games/bazookiasilentaffair.swf |
2.7 MB |
| Cool.Flash.Games/Games/bazookipocalypse.swf |
8.6 MB |
| Cool.Flash.Games/Games/Bear in Super Action Adventure 2.swf |
15.8 MB |
| Cool.Flash.Games/Games/Bear in Super Action Adventure.swf |
7.7 MB |
| Cool.Flash.Games/Games/bearbarians.swf |
6.9 MB |
| Cool.Flash.Games/Games/Beard Guy Goes Surfing.swf |
6 MB |
| Cool.Flash.Games/Games/bela_kovacs_and_the_trail_of_blood.swf |
8.7 MB |
| Cool.Flash.Games/Games/belial_chapter_1.swf |
3.4 MB |
| Cool.Flash.Games/Games/belialchapter2.5.swf |
4.8 MB |
| Cool.Flash.Games/Games/belialchapter2.swf |
7.1 MB |
| Cool.Flash.Games/Games/Berzerk Ball Homerun in Berzerk Land.swf |
5.4 MB |
| Cool.Flash.Games/Games/berzerk_ball.swf |
5.4 MB |
| Cool.Flash.Games/Games/berzerk_ball_2.swf |
12 MB |
| Cool.Flash.Games/Games/Big Pixel Zombies.swf |
3.3 MB |
| Cool.Flash.Games/Games/Bigotilyo.swf |
6.1 MB |
| Cool.Flash.Games/Games/billy_makin_kid.swf |
9.9 MB |
| Cool.Flash.Games/Games/billythepilot.swf |
3.7 MB |
| Cool.Flash.Games/Games/binga.swf |
4.9 MB |
| Cool.Flash.Games/Games/binga2.swf |
4.8 MB |
| Cool.Flash.Games/Games/birdblast.swf |
3.9 MB |
| Cool.Flash.Games/Games/Bite jacker.swf |
7.5 MB |
| Cool.Flash.Games/Games/bitzyblitz.swf |
6.9 MB |
| Cool.Flash.Games/Games/BLACK IV.swf |
11.9 MB |
| Cool.Flash.Games/Games/blackwoodprologue.swf |
7.1 MB |
| Cool.Flash.Games/Games/Blasting Agent.swf |
6.6 MB |
| Cool.Flash.Games/Games/blobescapefromlab16b.swf |
3.7 MB |
| Cool.Flash.Games/Games/Blobs Story 2.swf |
4.2 MB |
| Cool.Flash.Games/Games/blobsstory.swf |
2.4 MB |
| Cool.Flash.Games/Games/Blocks With Letters On 2.swf |
2.7 MB |
| Cool.Flash.Games/Games/Blocks With Letters On 3.swf |
2.7 MB |
| Cool.Flash.Games/Games/Blocks With Letters On 4.swf |
6.5 MB |
| Cool.Flash.Games/Games/Blocks With Letters On.swf |
2.7 MB |
| Cool.Flash.Games/Games/BLOCnog.swf |
2.1 MB |
| Cool.Flash.Games/Games/bloom_defender.swf |
8.4 MB |
| Cool.Flash.Games/Games/bloomo_a_submarine_adventure.swf |
11.8 MB |
| Cool.Flash.Games/Games/Bloons Series/Bloons 2.swf |
3.4 MB |
| Cool.Flash.Games/Games/Bloons Series/Bloons Player Pack 4.swf |
425 KB |
| Cool.Flash.Games/Games/Bloons Series/Bloons Player Pack 5.swf |
441 KB |
| Cool.Flash.Games/Games/Bloons Series/Bloons Pop Three.swf |
644 KB |
| Cool.Flash.Games/Games/Bloons Series/Bloons TD 5.swf |
14.6 MB |
| Cool.Flash.Games/Games/Bloons Series/Bloons Tower Defense 2.swf |
767 KB |
| Cool.Flash.Games/Games/Bloons Series/Bloons Tower Defense 3.swf |
1.3 MB |
| Cool.Flash.Games/Games/Bloons Series/Bloons Tower Defense.swf |
518 KB |
| Cool.Flash.Games/Games/Bloons Series/Bloons.swf |
510 KB |
| Cool.Flash.Games/Games/Bloons Series/bloons_player_pack_1.swf |
500 KB |
| Cool.Flash.Games/Games/Bloons Series/bloons_player_pack_2.swf |
506 KB |
| Cool.Flash.Games/Games/Bloons Series/bloons_super_monkey.swf |
2.6 MB |
| Cool.Flash.Games/Games/Bloons Series/bloons_tower_defense_4.swf |
2.8 MB |
| Cool.Flash.Games/Games/Blosics.swf |
404 KB |
| Cool.Flash.Games/Games/blosics2.swf |
4.6 MB |
| Cool.Flash.Games/Games/blosics2levelpack.swf |
4.9 MB |
| Cool.Flash.Games/Games/blosics3.swf |
5.2 MB |
| Cool.Flash.Games/Games/blueprint3d.swf |
11.3 MB |
| Cool.Flash.Games/Games/blym.swf |
4.5 MB |
| Cool.Flash.Games/Games/BNKR.swf |
9 MB |
| Cool.Flash.Games/Games/bobbys_not_so_average_adventure.swf |
8.5 MB |
| Cool.Flash.Games/Games/bobtherobber.swf |
8.8 MB |
| Cool.Flash.Games/Games/bobtherobber2.swf |
8.7 MB |
| Cool.Flash.Games/Games/boisdarc.swf |
7.6 MB |
| Cool.Flash.Games/Games/bomb diver.swf |
2.2 MB |
| Cool.Flash.Games/Games/Bombardment.swf |
2.7 MB |
| Cool.Flash.Games/Games/bomber_at_war_2_battle_for_resources.swf |
14.5 MB |
| Cool.Flash.Games/Games/bomber_at_war_2_level_pack.swf |
15.2 MB |
| Cool.Flash.Games/Games/bombrunner.swf |
9.9 MB |
| Cool.Flash.Games/Games/Bongo Boom Battlegrounds.swf |
633 KB |
| Cool.Flash.Games/Games/bonsai_worlds.swf |
3.5 MB |
| Cool.Flash.Games/Games/Boom Town.swf |
3.8 MB |
| Cool.Flash.Games/Games/boompirates.swf |
8 MB |
| Cool.Flash.Games/Games/Boss 101.swf |
3.3 MB |
| Cool.Flash.Games/Games/Boss Battle.swf |
1.8 MB |
| Cool.Flash.Games/Games/bossslayer.swf |
2.3 MB |
| Cool.Flash.Games/Games/Bouboum.swf |
17 KB |
| Cool.Flash.Games/Games/bounzy.swf |
892 KB |
| Cool.Flash.Games/Games/bounzy2.swf |
4.8 MB |
| Cool.Flash.Games/Games/BoxHead Series/Boxhead - A Halloween Special.swf |
677 KB |
| Cool.Flash.Games/Games/BoxHead Series/boxhead more rooms.swf |
2.3 MB |
| Cool.Flash.Games/Games/BoxHead Series/boxhead_2play.swf |
1.9 MB |
| Cool.Flash.Games/Games/BoxHead Series/boxhead_biever_and_baby.swf |
5.4 MB |
| Cool.Flash.Games/Games/BoxHead Series/boxhead_bounty_hunter.swf |
4.3 MB |
| Cool.Flash.Games/Games/BoxHead Series/boxhead_the_christmas_nightmare.swf |
5.9 MB |
| Cool.Flash.Games/Games/BoxHead Series/boxhead_the_nightmare.swf |
4.9 MB |
| Cool.Flash.Games/Games/BoxHead Series/boxhead_the_rooms.swf |
1.8 MB |
| Cool.Flash.Games/Games/BoxHead Series/boxhead_the_zombie_wars.swf |
2.5 MB |
| Cool.Flash.Games/Games/Brave_Heads.swf |
34.6 MB |
| Cool.Flash.Games/Games/brave_shorties.swf |
4 MB |
| Cool.Flash.Games/Games/brave_shorties_2.swf |
4.6 MB |
| Cool.Flash.Games/Games/bravekings.swf |
1.3 MB |
| Cool.Flash.Games/Games/Brawlin' Sailor.swf |
5.2 MB |
| Cool.Flash.Games/Games/Bright In The Screen.swf |
5.4 MB |
| Cool.Flash.Games/Games/briker.swf |
937 KB |
| Cool.Flash.Games/Games/briker2.swf |
5.7 MB |
| Cool.Flash.Games/Games/Bro_vs_Zombie.swf |
11 MB |
| Cool.Flash.Games/Games/BubbleQuod.swf |
6.8 MB |
| Cool.Flash.Games/Games/Buccaneer!.swf |
4.5 MB |
| Cool.Flash.Games/Games/bugongo.swf |
5.6 MB |
| Cool.Flash.Games/Games/Building Rush 2.swf |
9.8 MB |
| Cool.Flash.Games/Games/Building Rush.swf |
3.8 MB |
| Cool.Flash.Games/Games/buildingdemolisher.swf |
6.1 MB |
| Cool.Flash.Games/Games/buildup.swf |
9.3 MB |
| Cool.Flash.Games/Games/Bullet Heaven 2.swf |
22.8 MB |
| Cool.Flash.Games/Games/Bummin' A Ride.swf |
2.1 MB |
| Cool.Flash.Games/Games/Burger Cat.swf |
2 MB |
| Cool.Flash.Games/Games/burglar_hunt.swf |
925 KB |
| Cool.Flash.Games/Games/burrito bison revenge.swf |
8.3 MB |
| Cool.Flash.Games/Games/burrito bison.swf |
8.2 MB |
| Cool.Flash.Games/Games/bush royal rampage.swf |
2 MB |
| Cool.Flash.Games/Games/bush shoot-out.swf |
1.9 MB |
| Cool.Flash.Games/Games/Bustabrain.swf |
3.7 MB |
| Cool.Flash.Games/Games/bustabrain2.swf |
3.7 MB |
| Cool.Flash.Games/Games/Butterfly Fantasy.swf |
4 MB |
| Cool.Flash.Games/Games/Butterfly fantasy2.swf |
3.5 MB |
| Cool.Flash.Games/Games/butterfly_fantasy_3.swf |
4 MB |
| Cool.Flash.Games/Games/cabbagemaniac.swf |
2.7 MB |
| Cool.Flash.Games/Games/cactus-mccoy.swf |
6.4 MB |
| Cool.Flash.Games/Games/cactusmccoy2.swf |
9.9 MB |
| Cool.Flash.Games/Games/caesar_s_day_off.swf |
3.1 MB |
| Cool.Flash.Games/Games/call_of_sword.swf |
12.9 MB |
| Cool.Flash.Games/Games/Can You Escape Love.swf |
2.5 MB |
| Cool.Flash.Games/Games/canabalt.swf |
3.2 MB |
| Cool.Flash.Games/Games/candyconveyor.swf |
1.1 MB |
| Cool.Flash.Games/Games/canyon shooter.swf |
5 MB |
| Cool.Flash.Games/Games/Capn Marcela Parrot Charmer.swf |
7.9 MB |
| Cool.Flash.Games/Games/car eats car 2 deluxe.swf |
6.4 MB |
| Cool.Flash.Games/Games/car eats car 2.swf |
6.4 MB |
| Cool.Flash.Games/Games/Car Eats Car 3.swf |
10.3 MB |
| Cool.Flash.Games/Games/car eats car.swf |
5.3 MB |
| Cool.Flash.Games/Games/Caravaneer.swf |
6.4 MB |
| Cool.Flash.Games/Games/caravaneer_2.swf |
28.1 MB |
| Cool.Flash.Games/Games/cardboardboxassembler.swf |
10.2 MB |
| Cool.Flash.Games/Games/Cardinal Quest 2.swf |
18.1 MB |
| Cool.Flash.Games/Games/Cardinal Quest.swf |
8 MB |
| Cool.Flash.Games/Games/caribbean_admiral_2.swf |
12.6 MB |
| Cool.Flash.Games/Games/caribbeanadmiral.swf |
7.9 MB |
| Cool.Flash.Games/Games/carrot_fantasy_extreme.swf |
12.4 MB |
| Cool.Flash.Games/Games/castle cat 2.swf |
1 MB |
| Cool.Flash.Games/Games/Castle Cat 3.swf |
4.2 MB |
| Cool.Flash.Games/Games/castle cat.swf |
2.3 MB |
| Cool.Flash.Games/Games/Castle Quest.swf |
6.7 MB |
| Cool.Flash.Games/Games/Castle Wars 2.5.swf |
14.7 MB |
| Cool.Flash.Games/Games/castle_rush.swf |
7.5 MB |
| Cool.Flash.Games/Games/castle_woodwarf.swf |
15.9 MB |
| Cool.Flash.Games/Games/Casual Space.swf |
6.2 MB |
| Cool.Flash.Games/Games/Cat in Japan.swf |
1.5 MB |
| Cool.Flash.Games/Games/Catastrophe Escape.swf |
8.5 MB |
| Cool.Flash.Games/Games/catastrophi.swf |
3.2 MB |
| Cool.Flash.Games/Games/catchaduck.swf |
8.8 MB |
| Cool.Flash.Games/Games/catopult.swf |
2.4 MB |
| Cool.Flash.Games/Games/catsastronauts.swf |
1.2 MB |
| Cool.Flash.Games/Games/cellar_door.swf |
15.7 MB |
| Cool.Flash.Games/Games/celsium.swf |
6.7 MB |
| Cool.Flash.Games/Games/chancealot.swf |
5.6 MB |
| Cool.Flash.Games/Games/chaos-faction.swf |
5.5 MB |
| Cool.Flash.Games/Games/chaos_faction_2.swf |
11.8 MB |
| Cool.Flash.Games/Games/chef_day.swf |
5.2 MB |
| Cool.Flash.Games/Games/chess_strategy.swf |
951 KB |
| Cool.Flash.Games/Games/chibi_knight.swf |
6.6 MB |
| Cool.Flash.Games/Games/chief.swf |
4.1 MB |
| Cool.Flash.Games/Games/Child of a Witch 1.swf |
4.4 MB |
| Cool.Flash.Games/Games/Child of a Witch 2.swf |
4.1 MB |
| Cool.Flash.Games/Games/Child of a Witch 3.swf |
4.2 MB |
| Cool.Flash.Games/Games/Ching Chong Beautiful.swf |
13.1 MB |
| Cool.Flash.Games/Games/chocolate_rambo.swf |
4.6 MB |
| Cool.Flash.Games/Games/Choose Your Weapon Series/Choose Your Weapon 3.swf |
3.2 MB |
| Cool.Flash.Games/Games/Choose Your Weapon Series/Choose Your Weapon 4.swf |
2.4 MB |
| Cool.Flash.Games/Games/Choose Your Weapon Series/Choose Your Weapon 5.swf |
17.3 MB |
| Cool.Flash.Games/Games/Choose Your Weapon Series/choose your weapon1.swf |
3 MB |
| Cool.Flash.Games/Games/Choose Your Weapon Series/choose your weapon2.swf |
2.6 MB |
| Cool.Flash.Games/Games/christmasrunner.swf |
2.2 MB |
| Cool.Flash.Games/Games/Chromatic.swf |
974 KB |
| Cool.Flash.Games/Games/Cinema Madness.swf |
7.9 MB |
| Cool.Flash.Games/Games/circus.swf |
3.8 MB |
| Cool.Flash.Games/Games/City Siege Series/City Siege 3 FUBAR Level Pack.swf |
5.7 MB |
| Cool.Flash.Games/Games/City Siege Series/city_siege.swf |
3.1 MB |
| Cool.Flash.Games/Games/City Siege Series/city_siege_-_sniper.swf |
4.9 MB |
| Cool.Flash.Games/Games/City Siege Series/city_siege_2_-_resort_siege.swf |
3.6 MB |
| Cool.Flash.Games/Games/City Siege Series/city_siege_3_jungle_siege.swf |
4.6 MB |
| Cool.Flash.Games/Games/City Siege Series/City_Siege_4_Alien_Siege.swf |
5.4 MB |
| Cool.Flash.Games/Games/civilization_wars_4_monsters.swf |
12.3 MB |
| Cool.Flash.Games/Games/Clear Vision Series/clear_vision.swf |
2.7 MB |
| Cool.Flash.Games/Games/Clear Vision Series/clear_vision_2.swf |
9.2 MB |
| Cool.Flash.Games/Games/Clear Vision Series/clear_vision_4.swf |
10.3 MB |
| Cool.Flash.Games/Games/Clear Vision Series/clear_vision_5.swf |
15.3 MB |
| Cool.Flash.Games/Games/Clear Vision Series/clear_vision_elite.swf |
9.3 MB |
| Cool.Flash.Games/Games/Click The Frog.swf |
1.9 MB |
| Cool.Flash.Games/Games/clicker_troops.swf |
8.1 MB |
| Cool.Flash.Games/Games/ClickPLAY series/Clickplay 2.swf |
2.1 MB |
| Cool.Flash.Games/Games/ClickPLAY series/ClickPLAY!.swf |
866 KB |
| Cool.Flash.Games/Games/ClickPLAY series/clickplay-quickfire 2.swf |
4.7 MB |
| Cool.Flash.Games/Games/ClickPLAY series/clickplay3.swf |
3 MB |
| Cool.Flash.Games/Games/ClickPLAY series/clickplayquickfire1.swf |
4.7 MB |
| Cool.Flash.Games/Games/ClickPLAY series/clickplayquickfire3.swf |
6.1 MB |
| Cool.Flash.Games/Games/ClickPLAY series/clickplayrainbow.swf |
4.3 MB |
| Cool.Flash.Games/Games/ClickPLAY series/clickplayrainbow2.swf |
5.7 MB |
| Cool.Flash.Games/Games/ClickPLAY series/clickplaytime-1_0.swf |
3 MB |
| Cool.Flash.Games/Games/ClickPLAY series/clickplaytime-2.swf |
3.6 MB |
| Cool.Flash.Games/Games/ClickPLAY series/clickplaytime-3.swf |
951 KB |
| Cool.Flash.Games/Games/ClickPLAY series/clickplaytime-4.swf |
3.6 MB |
| Cool.Flash.Games/Games/Clockwork Cat.swf |
542 KB |
| Cool.Flash.Games/Games/Closure.swf |
7.2 MB |
| Cool.Flash.Games/Games/ClueSweeper.swf |
1.4 MB |
| Cool.Flash.Games/Games/coign of vantage.swf |
1.2 MB |
| Cool.Flash.Games/Games/Coinbox Hero.swf |
5.1 MB |
| Cool.Flash.Games/Games/coldgrip.swf |
10.4 MB |
| Cool.Flash.Games/Games/collapseit.swf |
4.6 MB |
| Cool.Flash.Games/Games/collapseit2.swf |
6.7 MB |
| Cool.Flash.Games/Games/colliderix.swf |
1.1 MB |
| Cool.Flash.Games/Games/Color Carnage.swf |
731 KB |
| Cool.Flash.Games/Games/colortheory.swf |
928 KB |
| Cool.Flash.Games/Games/Coloruid 2.swf |
2.7 MB |
| Cool.Flash.Games/Games/Coloruid.swf |
2.7 MB |
| Cool.Flash.Games/Games/coma.swf |
8.4 MB |
| Cool.Flash.Games/Games/Comic_Book_Cody.swf |
4.9 MB |
| Cool.Flash.Games/Games/command_control.swf |
26.5 MB |
| Cool.Flash.Games/Games/commando.swf |
6.1 MB |
| Cool.Flash.Games/Games/commit5.swf |
5.1 MB |
| Cool.Flash.Games/Games/Compost.swf |
2.8 MB |
| Cool.Flash.Games/Games/concernedjoe.swf |
4.8 MB |
| Cool.Flash.Games/Games/continuity.swf |
4 MB |
| Cool.Flash.Games/Games/Convergence.swf |
17.6 MB |
| Cool.Flash.Games/Games/Cool Story Bro.swf |
9 MB |
| Cool.Flash.Games/Games/counter_terror.swf |
3.1 MB |
| Cool.Flash.Games/Games/Covert Front Series/Covert Front 2 station on the horizon.swf |
4.8 MB |
| Cool.Flash.Games/Games/Covert Front Series/Covert Front 3 Night in Zurich.swf |
9 MB |
| Cool.Flash.Games/Games/Covert Front Series/covert_front.swf |
3.9 MB |
| Cool.Flash.Games/Games/Covert Front Series/covert_front_4.swf |
11.6 MB |
| Cool.Flash.Games/Games/Cowlorful.swf |
4.8 MB |
| Cool.Flash.Games/Games/CP6.swf |
3.8 MB |
| Cool.Flash.Games/Games/crashtv.swf |
5.1 MB |
| Cool.Flash.Games/Games/Crayon Poke.swf |
2.2 MB |
| Cool.Flash.Games/Games/Crazy Christmas.swf |
11.6 MB |
| Cool.Flash.Games/Games/crazyhand.swf |
4.1 MB |
| Cool.Flash.Games/Games/Creative Kill Chamber Two!.swf |
2 MB |
| Cool.Flash.Games/Games/creative_kill_chamber.swf |
2 MB |
| Cool.Flash.Games/Games/creativelycomplicated.swf |
6.3 MB |
| Cool.Flash.Games/Games/creeping.swf |
13.9 MB |
| Cool.Flash.Games/Games/Creepos Tales 2.swf |
6.5 MB |
| Cool.Flash.Games/Games/Creepos Tales.swf |
4.9 MB |
| Cool.Flash.Games/Games/Crop Defenders.swf |
2 MB |
| Cool.Flash.Games/Games/Crow in Hell Series/a crow in hell 2.swf |
1.8 MB |
| Cool.Flash.Games/Games/Crow in Hell Series/a crow in hell 3.swf |
2.4 MB |
| Cool.Flash.Games/Games/Crow in Hell Series/a crow in hell.swf |
1.2 MB |
| Cool.Flash.Games/Games/Crow in Hell Series/crow in hell - affliction.swf |
2.8 MB |
| Cool.Flash.Games/Games/crumpled.swf |
2.3 MB |
| Cool.Flash.Games/Games/Crunchdown.swf |
9.6 MB |
| Cool.Flash.Games/Games/crush the castle 2 players pack.swf |
10 MB |
| Cool.Flash.Games/Games/Crush_the_castle.swf |
2.2 MB |
| Cool.Flash.Games/Games/crush_the_castle_2.swf |
10.5 MB |
| Cool.Flash.Games/Games/crush_the_castle_players_pack.swf |
3.4 MB |
| Cool.Flash.Games/Games/crystal runner.swf |
6 MB |
| Cool.Flash.Games/Games/crystal_story_ii.swf |
23.7 MB |
| Cool.Flash.Games/Games/crystalstory.swf |
17.7 MB |
| Cool.Flash.Games/Games/Cube Escape Series/Cube Escape_ Arles.swf |
2.7 MB |
| Cool.Flash.Games/Games/Cube Escape Series/Cube Escape_ Birthday.swf |
8.9 MB |
| Cool.Flash.Games/Games/Cube Escape Series/Cube Escape_ Case 23.swf |
6.2 MB |
| Cool.Flash.Games/Games/Cube Escape Series/Cube Escape_ Harvey's Box.swf |
2.3 MB |
| Cool.Flash.Games/Games/Cube Escape Series/Cube Escape_ Seasons.swf |
7.1 MB |
| Cool.Flash.Games/Games/Cube Escape Series/Cube Escape_ The Cave.swf |
27.4 MB |
| Cool.Flash.Games/Games/Cube Escape Series/Cube Escape_ The Lake.swf |
2.3 MB |
| Cool.Flash.Games/Games/Cube Escape Series/Cube Escape_ The Mill.swf |
4.4 MB |
| Cool.Flash.Games/Games/Cube Escape Series/Cube Escape_ Theatre.swf |
7.8 MB |
| Cool.Flash.Games/Games/Cuboy Series/backtothecubeture1.swf |
12.3 MB |
| Cool.Flash.Games/Games/Cuboy Series/Cuboy Cubeture 2.swf |
30.2 MB |
| Cool.Flash.Games/Games/Cuboy Series/cuboy facebutt.swf |
2.4 MB |
| Cool.Flash.Games/Games/Cuboy Series/cuboy hot pants.swf |
3.9 MB |
| Cool.Flash.Games/Games/Cuboy Series/cuboy quest 2.swf |
2.4 MB |
| Cool.Flash.Games/Games/Cuboy Series/Cuboy Quest.swf |
744 KB |
| Cool.Flash.Games/Games/Cursed Treasure Dont Touch My Gems!.swf |
7.6 MB |
| Cool.Flash.Games/Games/cursed_treasure_2.swf |
20.2 MB |
| Cool.Flash.Games/Games/cursed_treasure_lp.swf |
8.3 MB |
| Cool.Flash.Games/Games/cursed_winds.swf |
1.5 MB |
| Cool.Flash.Games/Games/cursedtreasurelevelpack.swf |
7.3 MB |
| Cool.Flash.Games/Games/Cyber Chaser Counterthrust.swf |
12.5 MB |
| Cool.Flash.Games/Games/cyberchaser.swf |
10.4 MB |
| Cool.Flash.Games/Games/cyclomaniacs.swf |
4.3 MB |
| Cool.Flash.Games/Games/cyclomaniacs2.swf |
7.2 MB |
| Cool.Flash.Games/Games/cyclomaniacsepic.swf |
7.3 MB |
| Cool.Flash.Games/Games/D-Day Defender.swf |
3.2 MB |
| Cool.Flash.Games/Games/dad_n_me.swf |
2.6 MB |
| Cool.Flash.Games/Games/Dakota Winchesters Adventures - Part 2 Cactus City.swf |
7.5 MB |
| Cool.Flash.Games/Games/Dakota Winchesters Adventures.swf |
5.2 MB |
| Cool.Flash.Games/Games/Dale & Peakot.swf |
5.5 MB |
| Cool.Flash.Games/Games/damn birds 2.swf |
9.9 MB |
| Cool.Flash.Games/Games/Danger Dungeon.swf |
7.6 MB |
| Cool.Flash.Games/Games/Dangerous Adventure 2.swf |
19.6 MB |
| Cool.Flash.Games/Games/Dangerous adventure.swf |
12.6 MB |
| Cool.Flash.Games/Games/Dangerous Dungeons.swf |
5.5 MB |
| Cool.Flash.Games/Games/dangerous treasures.swf |
4.8 MB |
| Cool.Flash.Games/Games/Dark Cut 3.swf |
12.2 MB |
| Cool.Flash.Games/Games/dark_base_ii_-_the_hive.swf |
9.3 MB |
| Cool.Flash.Games/Games/dark_cut.swf |
926 KB |
| Cool.Flash.Games/Games/DarkBase 3 - Phoenix Team.swf |
9.3 MB |
| Cool.Flash.Games/Games/darkbase-2-4033.swf |
9.3 MB |
| Cool.Flash.Games/Games/Darkness 2.swf |
1.2 MB |
| Cool.Flash.Games/Games/darksoul.swf |
15.7 MB |
| Cool.Flash.Games/Games/Darktopia.swf |
5.2 MB |
| Cool.Flash.Games/Games/dawn_of_the_sniper.swf |
7.4 MB |
| Cool.Flash.Games/Games/dawn_of_the_sniper_2.swf |
9.3 MB |
| Cool.Flash.Games/Games/Daymare Series/Daymare Invaders.swf |
276 KB |
| Cool.Flash.Games/Games/Daymare Series/DayMare Town 2.swf |
1.6 MB |
| Cool.Flash.Games/Games/Daymare Series/Daymare Town 3.swf |
9.2 MB |
| Cool.Flash.Games/Games/Daymare Series/Daymare Town 4.swf |
13.1 MB |
| Cool.Flash.Games/Games/Daymare Series/DayMare Town.swf |
1.4 MB |
| Cool.Flash.Games/Games/Daymare Series/daymare_kite.swf |
1.7 MB |
| Cool.Flash.Games/Games/Daymare Series/daymarecat.swf |
6.3 MB |
| Cool.Flash.Games/Games/Days 2 Die - The Other Side.swf |
9.8 MB |
| Cool.Flash.Games/Games/days 2 die.swf |
5.6 MB |
| Cool.Flash.Games/Games/days_of_monsters.swf |
8.1 MB |
| Cool.Flash.Games/Games/daysofblood.swf |
16.8 MB |
| Cool.Flash.Games/Games/Dead End St..swf |
30 MB |
| Cool.Flash.Games/Games/dead paradise 2.swf |
11.9 MB |
| Cool.Flash.Games/Games/dead paradise 3.swf |
13.9 MB |
| Cool.Flash.Games/Games/dead paradise.swf |
11.1 MB |
| Cool.Flash.Games/Games/dead_drunk.swf |
1.8 MB |
| Cool.Flash.Games/Games/dead_zed.swf |
8.4 MB |
| Cool.Flash.Games/Games/dead_zed_2.swf |
11.1 MB |
| Cool.Flash.Games/Games/deadconvoy.swf |
4.4 MB |
| Cool.Flash.Games/Games/Deadly Neighbors 2.swf |
6.5 MB |
| Cool.Flash.Games/Games/Deadly Neighbours.swf |
4.1 MB |
| Cool.Flash.Games/Games/Deadly Road Trip.swf |
3 MB |
| Cool.Flash.Games/Games/Deadly Venom 2 - Origins.swf |
4.7 MB |
| Cool.Flash.Games/Games/Deadly Venom SA.swf |
5.5 MB |
| Cool.Flash.Games/Games/Deadly Venom.swf |
1.9 MB |
| Cool.Flash.Games/Games/deadly_venom_3.swf |
5.2 MB |
| Cool.Flash.Games/Games/Death Arena Reality Show.swf |
16.5 MB |
| Cool.Flash.Games/Games/deathcall.swf |
16 MB |
| Cool.Flash.Games/Games/deathlab.swf |
7.6 MB |
| Cool.Flash.Games/Games/Decision 2.swf |
12.6 MB |
| Cool.Flash.Games/Games/Decision.swf |
10.6 MB |
| Cool.Flash.Games/Games/decision_3.swf |
25.8 MB |
| Cool.Flash.Games/Games/Deep Sleep Series/deep sleep.swf |
4.3 MB |
| Cool.Flash.Games/Games/Deep Sleep Series/deeper sleep.swf |
11.8 MB |
| Cool.Flash.Games/Games/Deep Sleep Series/The Deepest Sleep.swf |
12.5 MB |
| Cool.Flash.Games/Games/deepandblue.swf |
9 MB |
| Cool.Flash.Games/Games/defence_of_the_portal.swf |
4.7 MB |
| Cool.Flash.Games/Games/defend your nuts.swf |
2 MB |
| Cool.Flash.Games/Games/defend-your-nuts.swf |
2 MB |
| Cool.Flash.Games/Games/defend_your_cabin.swf |
2.3 MB |
| Cool.Flash.Games/Games/Defend_Your_Nuts_2.swf |
4.6 MB |
| Cool.Flash.Games/Games/demonsdownunder.swf |
4.3 MB |
| Cool.Flash.Games/Games/demonsvsfairyland.swf |
11.2 MB |
| Cool.Flash.Games/Games/Depict1.swf |
3.9 MB |
| Cool.Flash.Games/Games/Despair.swf |
1.8 MB |
| Cool.Flash.Games/Games/Destination Kepler.swf |
19.3 MB |
| Cool.Flash.Games/Games/Detective Grimoire - The Beginning.swf |
15.6 MB |
| Cool.Flash.Games/Games/detective_grimoire.swf |
3.9 MB |
| Cool.Flash.Games/Games/deterministic_dungeon.swf |
18.2 MB |
| Cool.Flash.Games/Games/Dfragmente.swf |
11.1 MB |
| Cool.Flash.Games/Games/Diamond Hollow.swf |
2.9 MB |
| Cool.Flash.Games/Games/diamond_hollow_2.swf |
5.3 MB |
| Cool.Flash.Games/Games/Dibbles 4 A Christmas Crisis.swf |
4 MB |
| Cool.Flash.Games/Games/Dibbles Pro Pack.swf |
2.4 MB |
| Cool.Flash.Games/Games/dibbles-2-winter-woe.swf |
4.2 MB |
| Cool.Flash.Games/Games/dibbles_3.swf |
4.1 MB |
| Cool.Flash.Games/Games/dibblesforthegreatergood.swf |
2.3 MB |
| Cool.Flash.Games/Games/diggy.swf |
4.3 MB |
| Cool.Flash.Games/Games/digiwoog_disaster.swf |
20.6 MB |
| Cool.Flash.Games/Games/dino run escape extinction.swf |
3.8 MB |
| Cool.Flash.Games/Games/dino run marathon of doom.swf |
5.2 MB |
| Cool.Flash.Games/Games/dino_run_enter_planet_d.swf |
10.1 MB |
| Cool.Flash.Games/Games/Dinogen.swf |
21.1 MB |
| Cool.Flash.Games/Games/dinopanic.swf |
5.9 MB |
| Cool.Flash.Games/Games/dinoshift.swf |
5.9 MB |
| Cool.Flash.Games/Games/dinoshift2.swf |
4.5 MB |
| Cool.Flash.Games/Games/dirt_showdown.swf |
12.5 MB |
| Cool.Flash.Games/Games/Disaster Will Strike 5.swf |
11.1 MB |
| Cool.Flash.Games/Games/disaster_will_strike_6.swf |
8.1 MB |
| Cool.Flash.Games/Games/disaster_will_strike_7.swf |
15.8 MB |
| Cool.Flash.Games/Games/disasterwillstrike 4. ultimatedisaster.swf |
8.4 MB |
| Cool.Flash.Games/Games/disasterwillstrike.swf |
3.7 MB |
| Cool.Flash.Games/Games/disasterwillstrike2.swf |
5.6 MB |
| Cool.Flash.Games/Games/disasterwillstrike3.swf |
10.4 MB |
| Cool.Flash.Games/Games/discount mayonnaise.swf |
7.5 MB |
| Cool.Flash.Games/Games/Discovery.swf |
790 KB |
| Cool.Flash.Games/Games/diseviled.swf |
12.8 MB |
| Cool.Flash.Games/Games/diseviled_2.swf |
22.9 MB |
| Cool.Flash.Games/Games/divide.swf |
903 KB |
| Cool.Flash.Games/Games/Dog FightThe Ultimate War.swf |
2 MB |
| Cool.Flash.Games/Games/Dogfight 2.swf |
3.1 MB |
| Cool.Flash.Games/Games/dogfight.swf |
2 MB |
| Cool.Flash.Games/Games/Dojo of Death.swf |
825 KB |
| Cool.Flash.Games/Games/Dont Escape 2.swf |
10.2 MB |
| Cool.Flash.Games/Games/Dont Escape 3.swf |
10.8 MB |
| Cool.Flash.Games/Games/Dont Escape.swf |
6.3 MB |
| Cool.Flash.Games/Games/Dont Look Back.swf |
2.6 MB |
| Cool.Flash.Games/Games/doodle_devil.swf |
3.4 MB |
| Cool.Flash.Games/Games/doodle_god.swf |
3 MB |
| Cool.Flash.Games/Games/doodlegod2.swf |
4.6 MB |
| Cool.Flash.Games/Games/doom_triple_pack.swf |
10.7 MB |
| Cool.Flash.Games/Games/doors - daves free lessons.swf |
931 KB |
| Cool.Flash.Games/Games/doors 3 - locked out.swf |
1006 KB |
| Cool.Flash.Games/Games/Doors. Out of office.swf |
596 KB |
| Cool.Flash.Games/Games/doors2.swf |
1.1 MB |
| Cool.Flash.Games/Games/Doppelgänger.swf |
11.9 MB |
| Cool.Flash.Games/Games/down_is_up.swf |
1.2 MB |
| Cool.Flash.Games/Games/dragon age legends remix01.swf |
7.5 MB |
| Cool.Flash.Games/Games/Dragon Boy 2.swf |
9.9 MB |
| Cool.Flash.Games/Games/Dragon Boy.swf |
5.3 MB |
| Cool.Flash.Games/Games/Dragon's Quest.swf |
5.2 MB |
| Cool.Flash.Games/Games/dragon_age_journeys.swf |
17.9 MB |
| Cool.Flash.Games/Games/dragon_fortress.swf |
9.9 MB |
| Cool.Flash.Games/Games/dragon_quest.swf |
3.6 MB |
| Cool.Flash.Games/Games/dragon_s_gold.swf |
5.7 MB |
| Cool.Flash.Games/Games/draw and fly.swf |
9.2 MB |
| Cool.Flash.Games/Games/drawfender.swf |
5.8 MB |
| Cool.Flash.Games/Games/drawfender_level_pack.swf |
5.4 MB |
| Cool.Flash.Games/Games/driving_force.swf |
4.9 MB |
| Cool.Flash.Games/Games/driving_force_2.swf |
4.9 MB |
| Cool.Flash.Games/Games/driving_force_3.swf |
4.9 MB |
| Cool.Flash.Games/Games/driving_force_4.swf |
4.9 MB |
| Cool.Flash.Games/Games/Drunken Assasin.swf |
11.1 MB |
| Cool.Flash.Games/Games/dual_color_fairy.swf |
1.3 MB |
| Cool.Flash.Games/Games/dudeandzombies.swf |
1.2 MB |
| Cool.Flash.Games/Games/DUI.swf |
1.2 MB |
| Cool.Flash.Games/Games/Dummy Never Fails Community.swf |
3.3 MB |
| Cool.Flash.Games/Games/dummyneverfails.swf |
3.5 MB |
| Cool.Flash.Games/Games/dummyneverfails2.swf |
6.6 MB |
| Cool.Flash.Games/Games/dungeon runner.swf |
9.3 MB |
| Cool.Flash.Games/Games/dungeon_clicker.swf |
8.6 MB |
| Cool.Flash.Games/Games/dungeon_king.swf |
23 MB |
| Cool.Flash.Games/Games/dupligon.swf |
974 KB |
| Cool.Flash.Games/Games/Dusk 2.swf |
1.3 MB |
| Cool.Flash.Games/Games/dusk.swf |
5 MB |
| Cool.Flash.Games/Games/dynasty_war.swf |
11.6 MB |
| Cool.Flash.Games/Games/e7.swf |
3.6 MB |
| Cool.Flash.Games/Games/Earl Grey and This Rupert Guy.swf |
3.8 MB |
| Cool.Flash.Games/Games/Earn To Die Series/earn_to_die-2_exodus.swf |
7.1 MB |
| Cool.Flash.Games/Games/Earn To Die Series/earn_to_die.swf |
3.8 MB |
| Cool.Flash.Games/Games/Earn To Die Series/earn_to_die_2012.swf |
5.4 MB |
| Cool.Flash.Games/Games/Earn To Die Series/earn_to_die_2012_part_2.swf |
5.7 MB |
| Cool.Flash.Games/Games/Earth Taken 3.swf |
12.8 MB |
| Cool.Flash.Games/Games/earth_taken.swf |
8.7 MB |
| Cool.Flash.Games/Games/earth_taken_2.swf |
9.9 MB |
| Cool.Flash.Games/Games/earthbound.swf |
3.5 MB |
| Cool.Flash.Games/Games/Eastward Quest.swf |
3.9 MB |
| Cool.Flash.Games/Games/easyjoe.swf |
784 KB |
| Cool.Flash.Games/Games/easyjoe2.swf |
2 MB |
| Cool.Flash.Games/Games/easyjoe3.swf |
970 KB |
| Cool.Flash.Games/Games/easyjoe4.swf |
889 KB |
| Cool.Flash.Games/Games/Echoes Operation Stranglehold.swf |
32.5 MB |
| Cool.Flash.Games/Games/Ecotone.swf |
13.4 MB |
| Cool.Flash.Games/Games/egg_knight.swf |
3.6 MB |
| Cool.Flash.Games/Games/Eisydian Saga.swf |
10 MB |
| Cool.Flash.Games/Games/electricboy.swf |
8.6 MB |
| Cool.Flash.Games/Games/eleventhhour.swf |
3.7 MB |
| Cool.Flash.Games/Games/elfstory.swf |
7.8 MB |
| Cool.Flash.Games/Games/elite_squad.swf |
9.5 MB |
| Cool.Flash.Games/Games/emit.swf |
14.7 MB |
| Cool.Flash.Games/Games/empiresofarkeia.swf |
11.6 MB |
| Cool.Flash.Games/Games/endeavor.swf |
9.3 MB |
| Cool.Flash.Games/Games/ending.swf |
1.2 MB |
| Cool.Flash.Games/Games/energy_invaders.swf |
16.2 MB |
| Cool.Flash.Games/Games/engage.swf |
6.8 MB |
| Cool.Flash.Games/Games/Enigma.swf |
1.8 MB |
| Cool.Flash.Games/Games/enolaprelude.swf |
12.2 MB |
| Cool.Flash.Games/Games/Epic Boss Fighter 2.swf |
14.6 MB |
| Cool.Flash.Games/Games/epic_battle_fantasy_2.swf |
13.2 MB |
| Cool.Flash.Games/Games/epic_boss_fighter.swf |
6.2 MB |
| Cool.Flash.Games/Games/epic_time_pirates.swf |
13.1 MB |
| Cool.Flash.Games/Games/epic_war_3.swf |
12.4 MB |
| Cool.Flash.Games/Games/epic_war_4.swf |
14.9 MB |
| Cool.Flash.Games/Games/epicbattlefantasyadventurestory.swf |
6.3 MB |
| Cool.Flash.Games/Games/Escape from Jay is Games.swf |
3.3 MB |
| Cool.Flash.Games/Games/escape_from_26.swf |
5.3 MB |
| Cool.Flash.Games/Games/escape_the_phone_booth.swf |
950 KB |
| Cool.Flash.Games/Games/escapefromnightmare.swf |
6.4 MB |
| Cool.Flash.Games/Games/escapefrompuppydeathfactory.swf |
10.9 MB |
| Cool.Flash.Games/Games/escapetohell.swf |
3 MB |
| Cool.Flash.Games/Games/Escher.swf |
1.2 MB |
| Cool.Flash.Games/Games/evilforest.swf |
5.6 MB |
| Cool.Flash.Games/Games/Evilgeddon Spooky Max.swf |
7.2 MB |
| Cool.Flash.Games/Games/Excavate!.swf |
9.8 MB |
| Cool.Flash.Games/Games/experimentalshooter.swf |
5.5 MB |
| Cool.Flash.Games/Games/failman.swf |
9.7 MB |
| Cool.Flash.Games/Games/Faint.swf |
17.6 MB |
| Cool.Flash.Games/Games/fallenfromthemoon.swf |
1.9 MB |
| Cool.Flash.Games/Games/fancy_snowboarding.swf |
3.1 MB |
| Cool.Flash.Games/Games/fantasy carnage.swf |
3.9 MB |
| Cool.Flash.Games/Games/Faradays Flaw.swf |
34.9 MB |
| Cool.Flash.Games/Games/Farm-Express-3.swf |
5.1 MB |
| Cool.Flash.Games/Games/farm-express.swf |
11.8 MB |
| Cool.Flash.Games/Games/farm_doggie.swf |
2.3 MB |
| Cool.Flash.Games/Games/farm_express_2.swf |
1.9 MB |
| Cool.Flash.Games/Games/faster_than_zombies.swf |
8 MB |
| Cool.Flash.Games/Games/Fat Slice.swf |
276 KB |
| Cool.Flash.Games/Games/fatslice2.swf |
1.3 MB |
| Cool.Flash.Games/Games/faze.swf |
66 KB |
| Cool.Flash.Games/Games/fearless.swf |
4.5 MB |
| Cool.Flash.Games/Games/Feed Us Series/feed_us.swf |
3 MB |
| Cool.Flash.Games/Games/Feed Us Series/feed_us_-_lost_island.swf |
6.1 MB |
| Cool.Flash.Games/Games/Feed Us Series/feed_us_-_pirates.swf |
7.4 MB |
| Cool.Flash.Games/Games/Feed Us Series/feed_us_2.swf |
3.2 MB |
| Cool.Flash.Games/Games/Feed Us Series/feed_us_3.swf |
4.6 MB |
| Cool.Flash.Games/Games/Feed Us Series/feed_us_4.swf |
5.5 MB |
| Cool.Flash.Games/Games/Feed Us Series/feed_us_5.swf |
8.2 MB |
| Cool.Flash.Games/Games/Feed Us Series/feed_us_xmas_xpansion.swf |
5.9 MB |
| Cool.Flash.Games/Games/Feed Us Series/feedushappy.swf |
2.3 MB |
| Cool.Flash.Games/Games/feedfreddy.swf |
1.3 MB |
| Cool.Flash.Games/Games/fig8.swf |
2.9 MB |
| Cool.Flash.Games/Games/Finders Seekers.swf |
4.3 MB |
| Cool.Flash.Games/Games/Finding Jacks Treasure.swf |
4.6 MB |
| Cool.Flash.Games/Games/Fire_Catcher.swf |
8.5 MB |
| Cool.Flash.Games/Games/Fireboy & Watergirl Series/fireboy & watergirl 2 in the light temple.swf |
3.8 MB |
| Cool.Flash.Games/Games/Fireboy & Watergirl Series/Fireboy & Watergirl in The Crystal Temple.swf |
4.7 MB |
| Cool.Flash.Games/Games/Fireboy & Watergirl Series/fireboy & watergirl in the forest temple.swf |
1.8 MB |
| Cool.Flash.Games/Games/Fireboy & Watergirl Series/fireboy & watergirl in the ice temple.swf |
3.7 MB |
| Cool.Flash.Games/Games/Fireboy & Watergirl Series/fireboy & watergirl in the_forest_temple_3.swf |
1.8 MB |
| Cool.Flash.Games/Games/firebug.swf |
4 MB |
| Cool.Flash.Games/Games/firebug2.swf |
4.6 MB |
| Cool.Flash.Games/Games/fishy_waters.swf |
8 MB |
| Cool.Flash.Games/Games/fixation.swf |
16.3 MB |
| Cool.Flash.Games/Games/flaming_zombooka.swf |
1.6 MB |
| Cool.Flash.Games/Games/flaming_zombooka_2.swf |
3.6 MB |
| Cool.Flash.Games/Games/flaming_zombooka_3.swf |
5.3 MB |
| Cool.Flash.Games/Games/flamingzombooka2levelpack.swf |
3.7 MB |
| Cool.Flash.Games/Games/flash_s_bounty.swf |
5.5 MB |
| Cool.Flash.Games/Games/flawed_dimension.swf |
5.6 MB |
| Cool.Flash.Games/Games/flight.swf |
8.1 MB |
| Cool.Flash.Games/Games/Flood Runner Series/flood_runner_armageddon.swf |
3.3 MB |
| Cool.Flash.Games/Games/Flood Runner Series/floodrunner4.swf |
5 MB |
| Cool.Flash.Games/Games/Flood Runner Series/the flood runner 2.swf |
1.7 MB |
| Cool.Flash.Games/Games/Flood Runner Series/the Flood Runner.swf |
450 KB |
| Cool.Flash.Games/Games/floodedvillage.swf |
3.6 MB |
| Cool.Flash.Games/Games/floodfill.swf |
1.2 MB |
| Cool.Flash.Games/Games/focus.swf |
4 MB |
| Cool.Flash.Games/Games/folds-origamigame.swf |
2.5 MB |
| Cool.Flash.Games/Games/forbiddenarms.swf |
16.7 MB |
| Cool.Flash.Games/Games/Forgotten Hill Series/forgotten hill fall.swf |
9.3 MB |
| Cool.Flash.Games/Games/Forgotten Hill Series/Forgotten Hill puppeteer.swf |
13.2 MB |
| Cool.Flash.Games/Games/Forgotten Hill Series/Forgotten Hill Surgery.swf |
15.4 MB |
| Cool.Flash.Games/Games/Forgotten Hill Series/Forgotten Hill. Memento buried things.swf |
7.5 MB |
| Cool.Flash.Games/Games/Forgotten Hill Series/Forgotten Hill. Memento Love Beyond.swf |
6.7 MB |
| Cool.Flash.Games/Games/Forgotten Hill Series/Forgotten Hill. Memento Playground.swf |
11.4 MB |
| Cool.Flash.Games/Games/Forgotten Hill Series/Forgotten Hill. Memento run run little horse.swf |
5.4 MB |
| Cool.Flash.Games/Games/fort blaster ahoy there.swf |
6.8 MB |
| Cool.Flash.Games/Games/Fortune Hunter Wrath of Anubis.swf |
3.3 MB |
| Cool.Flash.Games/Games/fractured.swf |
5.5 MB |
| Cool.Flash.Games/Games/fractured2.swf |
7.2 MB |
| Cool.Flash.Games/Games/franknslime.swf |
4.9 MB |
| Cool.Flash.Games/Games/Frantic 2.swf |
5.7 MB |
| Cool.Flash.Games/Games/frantic 3.swf |
12.9 MB |
| Cool.Flash.Games/Games/frantic.swf |
3.3 MB |
| Cool.Flash.Games/Games/franticfrigates.swf |
4 MB |
| Cool.Flash.Games/Games/freakolantern.swf |
18.2 MB |
| Cool.Flash.Games/Games/free_icecream.swf |
5 MB |
| Cool.Flash.Games/Games/freedom-tower.swf |
6.4 MB |
| Cool.Flash.Games/Games/freedomtower2.swf |
16.2 MB |
| Cool.Flash.Games/Games/Freeway Fury 2.swf |
9.6 MB |
| Cool.Flash.Games/Games/freeway fury 3.swf |
12.5 MB |
| Cool.Flash.Games/Games/freeway-fury.swf |
5.8 MB |
| Cool.Flash.Games/Games/friendlywormholes.swf |
992 KB |
| Cool.Flash.Games/Games/Frog Fable.swf |
7.4 MB |
| Cool.Flash.Games/Games/frogout.swf |
4.5 MB |
| Cool.Flash.Games/Games/frozen_islands_new_horizons.swf |
16.2 MB |
| Cool.Flash.Games/Games/frozenislands.swf |
10.4 MB |
| Cool.Flash.Games/Games/frustrabit.swf |
2.1 MB |
| Cool.Flash.Games/Games/furtivedao.swf |
14 MB |
| Cool.Flash.Games/Games/g-switch-2.swf |
7.6 MB |
| Cool.Flash.Games/Games/g-switch-3.swf |
10.9 MB |
| Cool.Flash.Games/Games/g-switch.swf |
2.4 MB |
| Cool.Flash.Games/Games/Galaxy Jumper.swf |
3.2 MB |
| Cool.Flash.Games/Games/Game in Ten Seconds.swf |
69 KB |
| Cool.Flash.Games/Games/game_over_gopher.swf |
8.8 MB |
| Cool.Flash.Games/Games/gangsta_bean.swf |
6.1 MB |
| Cool.Flash.Games/Games/Gangster Bros.swf |
953 KB |
| Cool.Flash.Games/Games/Gap Monsters.swf |
2.5 MB |
| Cool.Flash.Games/Games/Garden Gnome Carnage.swf |
3 MB |
| Cool.Flash.Games/Games/gare.swf |
10 MB |
| Cool.Flash.Games/Games/gemcaveadventure.swf |
2.7 MB |
| Cool.Flash.Games/Games/gentlegravity.swf |
12.9 MB |
| Cool.Flash.Games/Games/gentlemens_club.swf |
11.5 MB |
| Cool.Flash.Games/Games/Get Home.swf |
5.6 MB |
| Cool.Flash.Games/Games/Ghostly Me.swf |
1.7 MB |
| Cool.Flash.Games/Games/Ghosts Stole My Puppy.swf |
943 KB |
| Cool.Flash.Games/Games/gingerbread_circus.swf |
1.2 MB |
| Cool.Flash.Games/Games/gingerbread_circus_2.swf |
4.3 MB |
| Cool.Flash.Games/Games/gingerbreadcircus3.swf |
7.4 MB |
| Cool.Flash.Games/Games/give_up.swf |
3.9 MB |
| Cool.Flash.Games/Games/give_up_2.swf |
11 MB |
| Cool.Flash.Games/Games/give_up_robot.swf |
2.6 MB |
| Cool.Flash.Games/Games/glean.swf |
9.7 MB |
| Cool.Flash.Games/Games/gluey2.swf |
1.1 MB |
| Cool.Flash.Games/Games/Go Go Plant 2.swf |
4.1 MB |
| Cool.Flash.Games/Games/go go plant.swf |
971 KB |
| Cool.Flash.Games/Games/Go Usagi Go.swf |
1 MB |
| Cool.Flash.Games/Games/goblin_treasure_hunt.swf |
19.5 MB |
| Cool.Flash.Games/Games/gogo gummo down in the dumps.swf |
4.6 MB |
| Cool.Flash.Games/Games/good daddy.swf |
4.6 MB |
| Cool.Flash.Games/Games/good daddy_2.swf |
7.4 MB |
| Cool.Flash.Games/Games/govirus.swf |
997 KB |
| Cool.Flash.Games/Games/grab_that_grub.swf |
7.9 MB |
| Cool.Flash.Games/Games/grannystrikesback.swf |
5 MB |
| Cool.Flash.Games/Games/gravity duck 2.swf |
1.3 MB |
| Cool.Flash.Games/Games/Gravity Duck.swf |
1.1 MB |
| Cool.Flash.Games/Games/Gravity Master.swf |
1.4 MB |
| Cool.Flash.Games/Games/gravity_guy.swf |
9.5 MB |
| Cool.Flash.Games/Games/gravitypop.swf |
1.1 MB |
| Cool.Flash.Games/Games/greenssurviveonlywhenredsdie.swf |
2.8 MB |
| Cool.Flash.Games/Games/GregManiacs.swf |
3.8 MB |
| Cool.Flash.Games/Games/gretel and hansel.swf |
9.8 MB |
| Cool.Flash.Games/Games/gretel_and_hansel_2.swf |
21.7 MB |
| Cool.Flash.Games/Games/Guardian Rock.swf |
3.7 MB |
| Cool.Flash.Games/Games/Guitar Geek.swf |
9.2 MB |
| Cool.Flash.Games/Games/Gun Mayhem 2More Mayhem.swf |
8.5 MB |
| Cool.Flash.Games/Games/Gun Mayhem Redux.swf |
6.9 MB |
| Cool.Flash.Games/Games/gun mayhem.swf |
5.7 MB |
| Cool.Flash.Games/Games/Gunball Reloaded.swf |
25.6 MB |
| Cool.Flash.Games/Games/gunball_2_-_emperors_revenge.swf |
9.2 MB |
| Cool.Flash.Games/Games/gunblood.swf |
1.8 MB |
| Cool.Flash.Games/Games/gunbot.swf |
4.4 MB |
| Cool.Flash.Games/Games/gunrox_gang_wars.swf |
1.5 MB |
| Cool.Flash.Games/Games/gunshotcowboy.swf |
7.7 MB |
| Cool.Flash.Games/Games/hack_slash_crawl.swf |
937 KB |
| Cool.Flash.Games/Games/Hambo 2 Hambtouchables.swf |
1.8 MB |
| Cool.Flash.Games/Games/hambo.swf |
785 KB |
| Cool.Flash.Games/Games/hanna in a choppa 2.swf |
8.8 MB |
| Cool.Flash.Games/Games/Hanna in a Choppa.swf |
1 MB |
| Cool.Flash.Games/Games/happydeadfriends.swf |
5 MB |
| Cool.Flash.Games/Games/happydeadfriendsplayerspack.swf |
5 MB |
| Cool.Flash.Games/Games/haunted_house.swf |
1.3 MB |
| Cool.Flash.Games/Games/Headless Zombie 2.swf |
8.7 MB |
| Cool.Flash.Games/Games/Headless Zombie.swf |
10.2 MB |
| Cool.Flash.Games/Games/Hello Worlds!.swf |
1.4 MB |
| Cool.Flash.Games/Games/Hero in the Ocean.swf |
5.8 MB |
| Cool.Flash.Games/Games/Hero SimulatorIdle Adventures.swf |
14.7 MB |
| Cool.Flash.Games/Games/hero_of_inferno.swf |
11.1 MB |
| Cool.Flash.Games/Games/hetherdale.swf |
10 MB |
| Cool.Flash.Games/Games/Hey Wizard!.swf |
4.6 MB |
| Cool.Flash.Games/Games/Hidden Valley Ninja.swf |
10.5 MB |
| Cool.Flash.Games/Games/higher.swf |
903 KB |
| Cool.Flash.Games/Games/hippolyta.swf |
14.5 MB |
| Cool.Flash.Games/Games/Hitstick Series/Hitstick 4 International Killer.swf |
3.2 MB |
| Cool.Flash.Games/Games/Hitstick Series/Hitstick 5.swf |
3.6 MB |
| Cool.Flash.Games/Games/Hitstick Series/Hitstick. Silence is over.swf |
859 KB |
| Cool.Flash.Games/Games/Hitstick Series/Hitstick2.swf |
2.7 MB |
| Cool.Flash.Games/Games/Hitstick Series/hitstick3.swf |
3 MB |
| Cool.Flash.Games/Games/Hitstick Series/hitstick6.swf |
3.3 MB |
| Cool.Flash.Games/Games/Hitstick Series/hitstick_rebirth.swf |
5.5 MB |
| Cool.Flash.Games/Games/hitthetroll.swf |
1.4 MB |
| Cool.Flash.Games/Games/Hobo Series/hobo.swf |
4.7 MB |
| Cool.Flash.Games/Games/Hobo Series/hobo_2_prison_brawl.swf |
4.9 MB |
| Cool.Flash.Games/Games/Hobo Series/hobo_3_wanted.swf |
5.4 MB |
| Cool.Flash.Games/Games/Hobo Series/hobo_4_total_war.swf |
6 MB |
| Cool.Flash.Games/Games/Hobo Series/hobo_5_space_brawl.swf |
7.7 MB |
| Cool.Flash.Games/Games/Hobo Series/hobo_6_hell.swf |
6.5 MB |
| Cool.Flash.Games/Games/Hobo Series/hobo_7_Heaven.swf |
6.8 MB |
| Cool.Flash.Games/Games/Hobo Series/hobo_vs_zombies.swf |
7.6 MB |
| Cool.Flash.Games/Games/holdthefort.swf |
8.1 MB |
| Cool.Flash.Games/Games/hole_in_the_wall_-_twisted_figures.swf |
1.2 MB |
| Cool.Flash.Games/Games/holiday_sim.swf |
1.9 MB |
| Cool.Flash.Games/Games/Home Sheep Home Series/Home Sheep Home.swf |
3.8 MB |
| Cool.Flash.Games/Games/Home Sheep Home Series/Home_Sheep_Home_2_Lost_In_London.swf |
11.4 MB |
| Cool.Flash.Games/Games/Home Sheep Home Series/home_sheep_home_2_lost_in_space.swf |
11.4 MB |
| Cool.Flash.Games/Games/Home Sheep Home Series/home_sheep_home_2_lost_underground.swf |
11.3 MB |
| Cool.Flash.Games/Games/hordesandlords.swf |
12.2 MB |
| Cool.Flash.Games/Games/Hostage_Crisis.swf |
6.7 MB |
| Cool.Flash.Games/Games/House of Dead Ninjas.swf |
5.6 MB |
| Cool.Flash.Games/Games/house_of_fear_revenge.swf |
16.8 MB |
| Cool.Flash.Games/Games/house_of_wolves.swf |
12.5 MB |
| Cool.Flash.Games/Games/How Smart Are You.swf |
6.8 MB |
| Cool.Flash.Games/Games/how_to_raise_a_dragon.swf |
1.8 MB |
| Cool.Flash.Games/Games/howdareyou.swf |
5.4 MB |
| Cool.Flash.Games/Games/howmonica.swf |
8 MB |
| Cool.Flash.Games/Games/huebrix.swf |
8.5 MB |
| Cool.Flash.Games/Games/humaliens-battle.swf |
7.7 MB |
| Cool.Flash.Games/Games/humaliensbattle2.swf |
8.2 MB |
| Cool.Flash.Games/Games/humbug.swf |
1 MB |
| Cool.Flash.Games/Games/Hummingbird Mind.swf |
3.1 MB |
| Cool.Flash.Games/Games/I Remain.swf |
2.1 MB |
| Cool.Flash.Games/Games/I Was Hungry But There Were Cannons.swf |
1.3 MB |
| Cool.Flash.Games/Games/I wish I were the Moon.swf |
680 KB |
| Cool.Flash.Games/Games/i-saw-her-standing-there.swf |
1.7 MB |
| Cool.Flash.Games/Games/i_dont_even_game.swf |
5.3 MB |
| Cool.Flash.Games/Games/i_saw_her_across_the_world.swf |
8.9 MB |
| Cool.Flash.Games/Games/icarus-needs.swf |
1.7 MB |
| Cool.Flash.Games/Games/Idle Skilling.swf |
54.8 MB |
| Cool.Flash.Games/Games/idle_sword.swf |
3.8 MB |
| Cool.Flash.Games/Games/idlers_and_dungeons.swf |
11.7 MB |
| Cool.Flash.Games/Games/ihave1day.swf |
6.1 MB |
| Cool.Flash.Games/Games/immortal_souls_dark_crusade.swf |
12.9 MB |
| Cool.Flash.Games/Games/incursion.swf |
15.5 MB |
| Cool.Flash.Games/Games/incursion_2_the_artifact.swf |
18.9 MB |
| Cool.Flash.Games/Games/Infectonator Series/infectonator.swf |
733 KB |
| Cool.Flash.Games/Games/Infectonator Series/infectonator_2.swf |
6.9 MB |
| Cool.Flash.Games/Games/Infectonator Series/infectonator_hot_chase.swf |
4.6 MB |
| Cool.Flash.Games/Games/Infectonator Series/infectonator_survivors.swf |
16.7 MB |
| Cool.Flash.Games/Games/Infectonator Series/infectonator_xmas.swf |
1015 KB |
| Cool.Flash.Games/Games/Infectonator Series/infectonatorwd.swf |
1.9 MB |
| Cool.Flash.Games/Games/infestor.swf |
2.9 MB |
| Cool.Flash.Games/Games/Infinity Inc.swf |
3.9 MB |
| Cool.Flash.Games/Games/ink`s_sleep.swf |
5.7 MB |
| Cool.Flash.Games/Games/Inquisitive Dave.swf |
5.2 MB |
| Cool.Flash.Games/Games/insectonator.swf |
2.3 MB |
| Cool.Flash.Games/Games/insectonator_zombie_mode.swf |
4.3 MB |
| Cool.Flash.Games/Games/insidia.swf |
2.4 MB |
| Cool.Flash.Games/Games/install_d.swf |
10.2 MB |
| Cool.Flash.Games/Games/Into_Space_2.swf |
11.9 MB |
| Cool.Flash.Games/Games/intospace.swf |
5.9 MB |
| Cool.Flash.Games/Games/intruder_combat_training_2x.swf |
13.1 MB |
| Cool.Flash.Games/Games/intrusion.swf |
5.2 MB |
| Cool.Flash.Games/Games/intrusion_2.swf |
18.2 MB |
| Cool.Flash.Games/Games/iq_ball.swf |
2.2 MB |
| Cool.Flash.Games/Games/iquitmustdash.swf |
3.7 MB |
| Cool.Flash.Games/Games/Iron Knight.swf |
7.9 MB |
| Cool.Flash.Games/Games/isoballx1.swf |
1.3 MB |
| Cool.Flash.Games/Games/jackoinhell.swf |
3.4 MB |
| Cool.Flash.Games/Games/jackoinhell2.swf |
4.7 MB |
| Cool.Flash.Games/Games/jackthezombie.swf |
3.7 MB |
| Cool.Flash.Games/Games/jake_s_tough_break.swf |
2.9 MB |
| Cool.Flash.Games/Games/jellycannon.swf |
1.1 MB |
| Cool.Flash.Games/Games/Jellydad Hero.swf |
6.5 MB |
| Cool.Flash.Games/Games/jellyescape.swf |
7.9 MB |
| Cool.Flash.Games/Games/jellygo.swf |
8.2 MB |
| Cool.Flash.Games/Games/jellytruck.swf |
4.2 MB |
| Cool.Flash.Games/Games/Jim Loves Mary.swf |
3.8 MB |
| Cool.Flash.Games/Games/jim_loves_mary_2.swf |
4.1 MB |
| Cool.Flash.Games/Games/Jo and Momo Forest Rush.swf |
7.1 MB |
| Cool.Flash.Games/Games/Jo99 games/coma45.swf |
4.5 MB |
| Cool.Flash.Games/Games/Jo99 games/hospital 46.swf |
5.8 MB |
| Cool.Flash.Games/Games/Jo99 games/humanoid 47.swf |
17.1 MB |
| Cool.Flash.Games/Games/Jo99 games/ilemysterieuse49.swf |
8.6 MB |
| Cool.Flash.Games/Games/Jo99 games/Krystine and the children in chains.swf |
35.9 MB |
| Cool.Flash.Games/Games/Jo99 games/The earl octopusor.swf |
31.5 MB |
| Cool.Flash.Games/Games/Jo99 games/The mother of the bird men.swf |
32 MB |
| Cool.Flash.Games/Games/Jo99 games/The queen of snakes.swf |
18.7 MB |
| Cool.Flash.Games/Games/johnny_rocketfingers.swf |
3.5 MB |
| Cool.Flash.Games/Games/johnny_rocketfingers_2.swf |
8.4 MB |
| Cool.Flash.Games/Games/johnny_upgrade.swf |
3.8 MB |
| Cool.Flash.Games/Games/K.O.L.M. 2.swf |
6.3 MB |
| Cool.Flash.Games/Games/k.o.l.m.swf |
2.6 MB |
| Cool.Flash.Games/Games/kamikazepigs.swf |
5.1 MB |
| Cool.Flash.Games/Games/katwalk.swf |
3.2 MB |
| Cool.Flash.Games/Games/keeperofthegrove.swf |
10.7 MB |
| Cool.Flash.Games/Games/kickthecritter.swf |
10.1 MB |
| Cool.Flash.Games/Games/Kill the Plumber 2.swf |
6.5 MB |
| Cool.Flash.Games/Games/Kill the Plumber.swf |
5.4 MB |
| Cool.Flash.Games/Games/Kill Your Nerves.swf |
4 MB |
| Cool.Flash.Games/Games/killbot.swf |
2.8 MB |
| Cool.Flash.Games/Games/Killer Escape 2.swf |
8.9 MB |
| Cool.Flash.Games/Games/Killer Escape 3.swf |
8.2 MB |
| Cool.Flash.Games/Games/killer_escape.swf |
9.3 MB |
| Cool.Flash.Games/Games/king_s_rush.swf |
7.6 MB |
| Cool.Flash.Games/Games/Kingdom of Liars 1.swf |
7.5 MB |
| Cool.Flash.Games/Games/Kingdom of Liars 2.swf |
9.2 MB |
| Cool.Flash.Games/Games/Kingdom of Liars 3.swf |
12.2 MB |
| Cool.Flash.Games/Games/kingdom_rush.swf |
30.7 MB |
| Cool.Flash.Games/Games/Kings Ascent.swf |
16.6 MB |
| Cool.Flash.Games/Games/kings_guard.swf |
8.2 MB |
| Cool.Flash.Games/Games/kingsgame.swf |
6.8 MB |
| Cool.Flash.Games/Games/kingsrider.swf |
2.3 MB |
| Cool.Flash.Games/Games/kingstory.swf |
1.9 MB |
| Cool.Flash.Games/Games/kit and the octopod.swf |
5.9 MB |
| Cool.Flash.Games/Games/kleinecastle.swf |
3.5 MB |
| Cool.Flash.Games/Games/Knightfall 2.swf |
9.5 MB |
| Cool.Flash.Games/Games/Knightfall.swf |
6.3 MB |
| Cool.Flash.Games/Games/Knightmare_Tower.swf |
6.6 MB |
| Cool.Flash.Games/Games/Knights_vs_Zombies.swf |
6.1 MB |
| Cool.Flash.Games/Games/knighttron.swf |
23.4 MB |
| Cool.Flash.Games/Games/koutack.swf |
1.1 MB |
| Cool.Flash.Games/Games/Kram Keep.swf |
7.1 MB |
| Cool.Flash.Games/Games/KripperZ.swf |
4.7 MB |
| Cool.Flash.Games/Games/L.I.F.E..swf |
7.1 MB |
| Cool.Flash.Games/Games/lab.swf |
3.2 MB |
| Cool.Flash.Games/Games/lab_of_the_dead.swf |
27.8 MB |
| Cool.Flash.Games/Games/lakeview_cabin.swf |
7.3 MB |
| Cool.Flash.Games/Games/lancelost.swf |
2.2 MB |
| Cool.Flash.Games/Games/LARRY and the GNOMES.swf |
17.6 MB |
| Cool.Flash.Games/Games/Laser Cannon 3 Levels Pack.swf |
4.9 MB |
| Cool.Flash.Games/Games/lasercannon.swf |
3.1 MB |
| Cool.Flash.Games/Games/lasercannon2.swf |
2.4 MB |
| Cool.Flash.Games/Games/lasercannon3.swf |
5.2 MB |
| Cool.Flash.Games/Games/Last Legacy Null Space.swf |
19.6 MB |
| Cool.Flash.Games/Games/lasttown.swf |
3.8 MB |
| Cool.Flash.Games/Games/lavaclimber.swf |
4.5 MB |
| Cool.Flash.Games/Games/League of Legends Cho'Gath Eats the World.swf |
38.9 MB |
| Cool.Flash.Games/Games/learn to fly 3.swf |
16.7 MB |
| Cool.Flash.Games/Games/learn_to_fly.swf |
854 KB |
| Cool.Flash.Games/Games/learntofly2.swf |
5.1 MB |
| Cool.Flash.Games/Games/Lee Lee's Quest.swf |
4.1 MB |
| Cool.Flash.Games/Games/lee_lee_s_quest_2.swf |
7.6 MB |
| Cool.Flash.Games/Games/Legend of the Void.swf |
11.9 MB |
| Cool.Flash.Games/Games/legend_of_johnny.swf |
12.6 MB |
| Cool.Flash.Games/Games/legionofredwolves.swf |
13 MB |
| Cool.Flash.Games/Games/let_s_journey.swf |
6.7 MB |
| Cool.Flash.Games/Games/let_s_journey_2.swf |
8.6 MB |
| Cool.Flash.Games/Games/Lethal RPG War Begins.swf |
15.7 MB |
| Cool.Flash.Games/Games/letitslide.swf |
1.2 MB |
| Cool.Flash.Games/Games/Level Editor Series/Level Editor 4.swf |
4.4 MB |
| Cool.Flash.Games/Games/Level Editor Series/level-editor.swf |
4.3 MB |
| Cool.Flash.Games/Games/Level Editor Series/level_editor_3.swf |
3.7 MB |
| Cool.Flash.Games/Games/Level Editor Series/leveleditor2.swf |
2.5 MB |
| Cool.Flash.Games/Games/levelup.swf |
3.1 MB |
| Cool.Flash.Games/Games/lightmyfire.swf |
902 KB |
| Cool.Flash.Games/Games/lightquest.swf |
4.3 MB |
| Cool.Flash.Games/Games/like_vampire_like_son.swf |
5.7 MB |
| Cool.Flash.Games/Games/lineoffire.swf |
7.6 MB |
| Cool.Flash.Games/Games/liquid.swf |
4.2 MB |
| Cool.Flash.Games/Games/liquid2.swf |
8.3 MB |
| Cool.Flash.Games/Games/Little Fins.swf |
1.3 MB |
| Cool.Flash.Games/Games/little_wheel.swf |
9.2 MB |
| Cool.Flash.Games/Games/littleloki.swf |
877 KB |
| Cool.Flash.Games/Games/littlesheep.swf |
1.1 MB |
| Cool.Flash.Games/Games/littlewars.swf |
9.1 MB |
| Cool.Flash.Games/Games/live2work.swf |
1.3 MB |
| Cool.Flash.Games/Games/Lone Survivor Demo.swf |
19.2 MB |
| Cool.Flash.Games/Games/lonewolf.swf |
39.9 MB |
| Cool.Flash.Games/Games/long_way.swf |
7.9 MB |
| Cool.Flash.Games/Games/Look_out_Mr_Johnson.swf |
9.1 MB |
| Cool.Flash.Games/Games/Looming.swf |
1.9 MB |
| Cool.Flash.Games/Games/loondon.swf |
9.4 MB |
| Cool.Flash.Games/Games/loops of zen.swf |
36 KB |
| Cool.Flash.Games/Games/Loot Heroes 2.swf |
7.7 MB |
| Cool.Flash.Games/Games/Loot Heroes Clicker.swf |
13.3 MB |
| Cool.Flash.Games/Games/loot_hero.swf |
9.1 MB |
| Cool.Flash.Games/Games/loot_heroes.swf |
6.6 MB |
| Cool.Flash.Games/Games/loot_heroes_ii.swf |
7.7 MB |
| Cool.Flash.Games/Games/lostars.swf |
927 KB |
| Cool.Flash.Games/Games/lostoutpost.swf |
14 MB |
| Cool.Flash.Games/Games/love_chase.swf |
17.4 MB |
| Cool.Flash.Games/Games/Loved.swf |
2.6 MB |
| Cool.Flash.Games/Games/Lucass Quest Backwards.swf |
1.8 MB |
| Cool.Flash.Games/Games/lucky tower.swf |
9.2 MB |
| Cool.Flash.Games/Games/lucky_tower_2.swf |
25.7 MB |
| Cool.Flash.Games/Games/mad-day.swf |
6.3 MB |
| Cool.Flash.Games/Games/mad_day_2.swf |
14.2 MB |
| Cool.Flash.Games/Games/madburger.swf |
5.2 MB |
| Cool.Flash.Games/Games/madburger3.swf |
8.4 MB |
| Cool.Flash.Games/Games/MadBurger_2.swf |
8.2 MB |
| Cool.Flash.Games/Games/madeinmafia.swf |
7.2 MB |
| Cool.Flash.Games/Games/Madness Series/Madness Premeditation.swf |
5.6 MB |
| Cool.Flash.Games/Games/Madness Series/Madness Project Nexus mod III.swf |
19.5 MB |
| Cool.Flash.Games/Games/Madness Series/Madness Retaliation.swf |
1.7 MB |
| Cool.Flash.Games/Games/Madness Series/madness-project_nexus.swf |
14.9 MB |
| Cool.Flash.Games/Games/Madness Series/madness-regent.swf |
5.4 MB |
| Cool.Flash.Games/Games/Madness Series/madness_accelerant.swf |
17.1 MB |
| Cool.Flash.Games/Games/Madness Series/madness_hydraulic.swf |
17.5 MB |
| Cool.Flash.Games/Games/madville.swf |
8 MB |
| Cool.Flash.Games/Games/Mafia - The Betrayer.swf |
4.9 MB |
| Cool.Flash.Games/Games/mafiastories.swf |
7.4 MB |
| Cool.Flash.Games/Games/mage_runner.swf |
7.8 MB |
| Cool.Flash.Games/Games/magic orbs.swf |
6.6 MB |
| Cool.Flash.Games/Games/magicsteel.swf |
5.5 MB |
| Cool.Flash.Games/Games/magnetizr.swf |
8.6 MB |
| Cool.Flash.Games/Games/makingmonkeys.swf |
6.1 MB |
| Cool.Flash.Games/Games/mandrake.swf |
8.6 MB |
| Cool.Flash.Games/Games/maplewood_junior_high.swf |
11.9 MB |
| Cool.Flash.Games/Games/Marrakesh Club.swf |
8.9 MB |
| Cool.Flash.Games/Games/mastermind-world-conqueror.swf |
17.9 MB |
| Cool.Flash.Games/Games/matchdayofthedead.swf |
4 MB |
| Cool.Flash.Games/Games/max_fury.swf |
8.4 MB |
| Cool.Flash.Games/Games/maxploder.swf |
3.9 MB |
| Cool.Flash.Games/Games/Me and My Dinosaur.swf |
5.4 MB |
| Cool.Flash.Games/Games/me and the key 2.swf |
3.3 MB |
| Cool.Flash.Games/Games/me and the key.swf |
3.5 MB |
| Cool.Flash.Games/Games/me-and-the-key-3.swf |
2.7 MB |
| Cool.Flash.Games/Games/Meat boy - Map Pack.swf |
5.6 MB |
| Cool.Flash.Games/Games/Meat Boy.swf |
5.3 MB |
| Cool.Flash.Games/Games/mechanicalcommando.swf |
3 MB |
| Cool.Flash.Games/Games/mechanicalcommando2.swf |
8.5 MB |
| Cool.Flash.Games/Games/mega_mechs_2.swf |
11.5 MB |
| Cool.Flash.Games/Games/mega_miner.swf |
924 KB |
| Cool.Flash.Games/Games/memohuntress.swf |
15.5 MB |
| Cool.Flash.Games/Games/Menulis.swf |
1.8 MB |
| Cool.Flash.Games/Games/Midnight Cinema.swf |
21.2 MB |
| Cool.Flash.Games/Games/Midnight Hunter.swf |
5.3 MB |
| Cool.Flash.Games/Games/Midnight Spooks 2.swf |
7.8 MB |
| Cool.Flash.Games/Games/Midnight Spooks.swf |
8.3 MB |
| Cool.Flash.Games/Games/mighty_knight.swf |
16.6 MB |
| Cool.Flash.Games/Games/mike-shadow-i-paid-for-it.swf |
9.2 MB |
| Cool.Flash.Games/Games/min_hero_tower_of_sages.swf |
21.8 MB |
| Cool.Flash.Games/Games/mineit.swf |
10.3 MB |
| Cool.Flash.Games/Games/Mini Dash.swf |
15.8 MB |
| Cool.Flash.Games/Games/Mini_Commando.swf |
4.8 MB |
| Cool.Flash.Games/Games/minicraft.swf |
3.9 MB |
| Cool.Flash.Games/Games/Mining_Truck_2_Trolley_Transport.swf |
4.1 MB |
| Cool.Flash.Games/Games/miningtruck.swf |
2 MB |
| Cool.Flash.Games/Games/mirror.swf |
4.5 MB |
| Cool.Flash.Games/Games/mirror_runners.swf |
2.2 MB |
| Cool.Flash.Games/Games/missingmechanism.swf |
1.2 MB |
| Cool.Flash.Games/Games/missioninspacethelostcolony.swf |
12 MB |
| Cool.Flash.Games/Games/modern_tanks.swf |
2.8 MB |
| Cool.Flash.Games/Games/mogo_mogo.swf |
9.9 MB |
| Cool.Flash.Games/Games/Momentum_master.swf |
1.3 MB |
| Cool.Flash.Games/Games/Monster Detective.swf |
13 MB |
| Cool.Flash.Games/Games/Monster Legions.swf |
5.7 MB |
| Cool.Flash.Games/Games/Monster Love.swf |
10.8 MB |
| Cool.Flash.Games/Games/Monster Match.swf |
164 KB |
| Cool.Flash.Games/Games/Monster Squad.swf |
10.4 MB |
| Cool.Flash.Games/Games/monster_craft_2.swf |
11.2 MB |
| Cool.Flash.Games/Games/monster_frontier.swf |
18 MB |
| Cool.Flash.Games/Games/monster_mowdown.swf |
932 KB |
| Cool.Flash.Games/Games/monstercraft.swf |
7.5 MB |
| Cool.Flash.Games/Games/Monsterland Series/monsterland 2. junior revenge.swf |
2.5 MB |
| Cool.Flash.Games/Games/Monsterland Series/Monsterland 3. Junior Returns.swf |
3.1 MB |
| Cool.Flash.Games/Games/Monsterland Series/Monsterland 4. One more Junior.swf |
3.2 MB |
| Cool.Flash.Games/Games/Monsterland Series/monsterland. junior vs senior.swf |
1.9 MB |
| Cool.Flash.Games/Games/Monsters Den Chronicles.swf |
9.4 MB |
| Cool.Flash.Games/Games/monstersaga.swf |
11.9 MB |
| Cool.Flash.Games/Games/monsterstd2.swf |
11.9 MB |
| Cool.Flash.Games/Games/montreal mobility.swf |
3.2 MB |
| Cool.Flash.Games/Games/moonwaltz.swf |
2.5 MB |
| Cool.Flash.Games/Games/Morbid - Chapter 1.swf |
6.3 MB |
| Cool.Flash.Games/Games/Morbid Chapter 2.swf |
9.4 MB |
| Cool.Flash.Games/Games/more_zombies.swf |
8.9 MB |
| Cool.Flash.Games/Games/Morningstar.swf |
16.7 MB |
| Cool.Flash.Games/Games/morphing.swf |
1 MB |
| Cool.Flash.Games/Games/Mothball Series/mr mothball 2.swf |
951 KB |
| Cool.Flash.Games/Games/Mothball Series/mr mothball 3.swf |
337 KB |
| Cool.Flash.Games/Games/Mothball Series/mr mothball 4.swf |
665 KB |
| Cool.Flash.Games/Games/Mothball Series/mr mothball 5.swf |
1.5 MB |
| Cool.Flash.Games/Games/Mothball Series/mr mothball.swf |
924 KB |
| Cool.Flash.Games/Games/mouse and guns.swf |
2.3 MB |
| Cool.Flash.Games/Games/mr_splibox_2.swf |
9.7 MB |
| Cool.Flash.Games/Games/mr_splibox_the_christmas_story.swf |
9.2 MB |
| Cool.Flash.Games/Games/mr_vengeance_act-i.swf |
11.6 MB |
| Cool.Flash.Games/Games/mr_vengeance_act_3.swf |
23.4 MB |
| Cool.Flash.Games/Games/mr_vengeance_act_ii.swf |
19.6 MB |
| Cool.Flash.Games/Games/mr_vengeance_upgrade.swf |
18.2 MB |
| Cool.Flash.Games/Games/mrbreereturninghome.swf |
19 MB |
| Cool.Flash.Games/Games/mrsplibox.swf |
7 MB |
| Cool.Flash.Games/Games/Ms Vision by Proxy.swf |
10.6 MB |
| Cool.Flash.Games/Games/murder.swf |
7.6 MB |
| Cool.Flash.Games/Games/murder_mystery.swf |
39.5 MB |
| Cool.Flash.Games/Games/musequest.swf |
5.6 MB |
| Cool.Flash.Games/Games/mushbits.swf |
4.5 MB |
| Cool.Flash.Games/Games/mushbits2.swf |
4.6 MB |
| Cool.Flash.Games/Games/Mushroom Madness 2.swf |
6 MB |
| Cool.Flash.Games/Games/mushroom madness 3.swf |
6.7 MB |
| Cool.Flash.Games/Games/mushroom madness.swf |
4.6 MB |
| Cool.Flash.Games/Games/mushroomer.swf |
5.2 MB |
| Cool.Flash.Games/Games/mustache attack.swf |
6.8 MB |
| Cool.Flash.Games/Games/mustescapetheisland.swf |
897 KB |
| Cool.Flash.Games/Games/Mutant Alien Assault.swf |
1.9 MB |
| Cool.Flash.Games/Games/muu just another day.swf |
9.8 MB |
| Cool.Flash.Games/Games/My Little Army.swf |
14.1 MB |
| Cool.Flash.Games/Games/my_friend_pedro_arena.swf |
3.1 MB |
| Cool.Flash.Games/Games/myangel.swf |
2.8 MB |
| Cool.Flash.Games/Games/myfriendpedro.swf |
3.8 MB |
| Cool.Flash.Games/Games/mylifeisyours.swf |
7.9 MB |
| Cool.Flash.Games/Games/Mystery IQ Test.swf |
5.9 MB |
| Cool.Flash.Games/Games/N game.swf |
999 KB |
| Cool.Flash.Games/Games/Nano Kingdoms.swf |
12.3 MB |
| Cool.Flash.Games/Games/Nano Ninja.swf |
522 KB |
| Cool.Flash.Games/Games/Nayas Quest.swf |
12.7 MB |
| Cool.Flash.Games/Games/Necronator 2.swf |
19.7 MB |
| Cool.Flash.Games/Games/Necronator.swf |
4.3 MB |
| Cool.Flash.Games/Games/neil_the_nail.swf |
8.5 MB |
| Cool.Flash.Games/Games/Nelly 2 ep.1.swf |
18.2 MB |
| Cool.Flash.Games/Games/nelly.swf |
6.6 MB |
| Cool.Flash.Games/Games/Nephis Adventure 2.swf |
22.6 MB |
| Cool.Flash.Games/Games/netherrunner.swf |
13.5 MB |
| Cool.Flash.Games/Games/Nevermore 3.swf |
5.7 MB |
| Cool.Flash.Games/Games/nevermore.swf |
910 KB |
| Cool.Flash.Games/Games/nevermore_2.swf |
1.9 MB |
| Cool.Flash.Games/Games/newspaper_boy.swf |
2 MB |
| Cool.Flash.Games/Games/newspaperboy2.swf |
2.5 MB |
| Cool.Flash.Games/Games/Newtons Law.swf |
9 MB |
| Cool.Flash.Games/Games/nextplease.swf |
1.7 MB |
| Cool.Flash.Games/Games/Nick Toldy and the Legend of Dragon Peninsula.swf |
12.1 MB |
| Cool.Flash.Games/Games/night_at_the_colosseum.swf |
10.8 MB |
| Cool.Flash.Games/Games/nightflies.swf |
6.3 MB |
| Cool.Flash.Games/Games/nightflies2.swf |
7.9 MB |
| Cool.Flash.Games/Games/nightlights.swf |
8.5 MB |
| Cool.Flash.Games/Games/nightmare_in_elmore.swf |
15.8 MB |
| Cool.Flash.Games/Games/Nightmares The Adventures Series/nightmares_the adventures 2 - Who Wants To Frame Hairy De Bully.swf |
1.2 MB |
| Cool.Flash.Games/Games/Nightmares The Adventures Series/nightmares_the_adventure_5.swf |
3.9 MB |
| Cool.Flash.Games/Games/Nightmares The Adventures Series/nightmares_the_adventures_1_broken_bones_complaint.swf |
1.2 MB |
| Cool.Flash.Games/Games/Nightmares The Adventures Series/nightmares_the_adventures_3_the_baron_of_vermin_famine.swf |
1.2 MB |
| Cool.Flash.Games/Games/Nightmares The Adventures Series/nightmares_the_adventures_4_the_stolen_souvenir_of_rob_r.swf |
2.8 MB |
| Cool.Flash.Games/Games/Ninja Glove.swf |
1.7 MB |
| Cool.Flash.Games/Games/ninja_rampage.swf |
926 KB |
| Cool.Flash.Games/Games/ninjaland.swf |
8.6 MB |
| Cool.Flash.Games/Games/Ninjufo.swf |
1.9 MB |
| Cool.Flash.Games/Games/No Time to Explain Remastered Demo.swf |
11 MB |
| Cool.Flash.Games/Games/no_time_to_explain.swf |
1.7 MB |
| Cool.Flash.Games/Games/nob_war_the_elves.swf |
1.1 MB |
| Cool.Flash.Games/Games/Nodes.swf |
1.2 MB |
| Cool.Flash.Games/Games/nomnation.swf |
10.7 MB |
| Cool.Flash.Games/Games/NONDEVICER.swf |
8.8 MB |
| Cool.Flash.Games/Games/Notebook Wars Series/Notebook Space Wars 2.swf |
4 MB |
| Cool.Flash.Games/Games/Notebook Wars Series/Notebook Space Wars.swf |
4.7 MB |
| Cool.Flash.Games/Games/Notebook Wars Series/notebookwars.swf |
2.5 MB |
| Cool.Flash.Games/Games/Notebook Wars Series/notebookwars2.swf |
3.8 MB |
| Cool.Flash.Games/Games/Notebook Wars Series/notebookwars3.swf |
4.2 MB |
| Cool.Flash.Games/Games/notinmydungeon.swf |
6.4 MB |
| Cool.Flash.Games/Games/nuclear gun.swf |
9.2 MB |
| Cool.Flash.Games/Games/nuclearplant.swf |
5.4 MB |
| Cool.Flash.Games/Games/Number Ninjas.swf |
1.9 MB |
| Cool.Flash.Games/Games/Numz.swf |
981 KB |
| Cool.Flash.Games/Games/Nunchuck Charlie A Love Story.swf |
2.6 MB |
| Cool.Flash.Games/Games/Ode To Pixel Days.swf |
11.3 MB |
| Cool.Flash.Games/Games/offspringfling.swf |
7.8 MB |
| Cool.Flash.Games/Games/oilnight.swf |
2.3 MB |
| Cool.Flash.Games/Games/omnomzombies.swf |
2.5 MB |
| Cool.Flash.Games/Games/onceuponalife.swf |
14.6 MB |
| Cool.Flash.Games/Games/One Button Bob.swf |
2.1 MB |
| Cool.Flash.Games/Games/one_chance.swf |
2.6 MB |
| Cool.Flash.Games/Games/oneandonestory.swf |
3.8 MB |
| Cool.Flash.Games/Games/onomastica.swf |
687 KB |
| Cool.Flash.Games/Games/onomastica2.swf |
1.5 MB |
| Cool.Flash.Games/Games/Orbox B.swf |
82 KB |
| Cool.Flash.Games/Games/orpheus.swf |
1.4 MB |
| Cool.Flash.Games/Games/Ossuary The Hodge-Podge Transformer.swf |
11 MB |
| Cool.Flash.Games/Games/outlawjack.swf |
1.2 MB |
| Cool.Flash.Games/Games/overhaul.swf |
8.9 MB |
| Cool.Flash.Games/Games/Owl's Nest.swf |
8.4 MB |
| Cool.Flash.Games/Games/packupthetoy.swf |
2.7 MB |
| Cool.Flash.Games/Games/PaintWorld.swf |
4.8 MB |
| Cool.Flash.Games/Games/paintworld2.swf |
5.9 MB |
| Cool.Flash.Games/Games/Paladin The Game.swf |
9.8 MB |
| Cool.Flash.Games/Games/paladin.swf |
9.7 MB |
| Cool.Flash.Games/Games/paladog.swf |
19.5 MB |
| Cool.Flash.Games/Games/Panda Star.swf |
929 KB |
| Cool.Flash.Games/Games/pandauprising.swf |
10 MB |
| Cool.Flash.Games/Games/Pandesal Boy.swf |
7.6 MB |
| Cool.Flash.Games/Games/Paper Venture.swf |
8.8 MB |
| Cool.Flash.Games/Games/papertrain.swf |
2 MB |
| Cool.Flash.Games/Games/paperwars.swf |
2.8 MB |
| Cool.Flash.Games/Games/Parallel Platformer.swf |
1.7 MB |
| Cool.Flash.Games/Games/parasite strike.swf |
10 MB |
| Cool.Flash.Games/Games/Paul & Percy.swf |
7.3 MB |
| Cool.Flash.Games/Games/pause ahead.swf |
15 MB |
| Cool.Flash.Games/Games/Payphone Mania!.swf |
10 MB |
| Cool.Flash.Games/Games/Peacefree Tactical Warfare.swf |
6.2 MB |
| Cool.Flash.Games/Games/Persist.swf |
8.3 MB |
| Cool.Flash.Games/Games/Personal Trip to the Moon.swf |
16.7 MB |
| Cool.Flash.Games/Games/perspective.swf |
3 MB |
| Cool.Flash.Games/Games/pestilence z.swf |
9.3 MB |
| Cool.Flash.Games/Games/peterthepenguin.swf |
903 KB |
| Cool.Flash.Games/Games/PewDuckPie.swf |
10.9 MB |
| Cool.Flash.Games/Games/pewduckpie_2.swf |
19.1 MB |
| Cool.Flash.Games/Games/pheusandmor.swf |
9.7 MB |
| Cool.Flash.Games/Games/photonbaby.swf |
2.7 MB |
| Cool.Flash.Games/Games/Pick & Dig 2.swf |
3.7 MB |
| Cool.Flash.Games/Games/Pick & Dig 3.swf |
3.3 MB |
| Cool.Flash.Games/Games/Pick & Dig.swf |
2.6 MB |
| Cool.Flash.Games/Games/Piece of Princess Cake.swf |
9.7 MB |
| Cool.Flash.Games/Games/Pieces.swf |
1.1 MB |
| Cool.Flash.Games/Games/piggywiggy3.swf |
10.5 MB |
| Cool.Flash.Games/Games/pigscanfly.swf |
1.2 MB |
| Cool.Flash.Games/Games/pillow_city.swf |
8.9 MB |
| Cool.Flash.Games/Games/pipe_riders.swf |
2.9 MB |
| Cool.Flash.Games/Games/Pipol Smasher.swf |
2.5 MB |
| Cool.Flash.Games/Games/pirateers.swf |
9.5 MB |
| Cool.Flash.Games/Games/pirates of the undead sea.swf |
9.5 MB |
| Cool.Flash.Games/Games/pixelcityskater.swf |
1.5 MB |
| Cool.Flash.Games/Games/pixelescape.swf |
7.6 MB |
| Cool.Flash.Games/Games/pixelquest.swf |
1.2 MB |
| Cool.Flash.Games/Games/Planet Wars.swf |
17.5 MB |
| Cool.Flash.Games/Games/planet_noevo.swf |
7.6 MB |
| Cool.Flash.Games/Games/planet_noevo_ii.swf |
14.7 MB |
| Cool.Flash.Games/Games/planetjuicer.swf |
8.7 MB |
| Cool.Flash.Games/Games/plantera.swf |
15.9 MB |
| Cool.Flash.Games/Games/plazma_burst_forward_to_the_past.swf |
3.7 MB |
| Cool.Flash.Games/Games/Plumber Pickle.swf |
2.9 MB |
| Cool.Flash.Games/Games/pocket creatures pvp.swf |
10.3 MB |
| Cool.Flash.Games/Games/polar tale.swf |
9.3 MB |
| Cool.Flash.Games/Games/Portal Defenders.swf |
8.5 MB |
| Cool.Flash.Games/Games/portal2d.swf |
4.1 MB |
| Cool.Flash.Games/Games/portal_the_flash_version.swf |
6.7 MB |
| Cool.Flash.Games/Games/portalquest.swf |
2.3 MB |
| Cool.Flash.Games/Games/pothead zombies.swf |
4.6 MB |
| Cool.Flash.Games/Games/potheadzombies2.swf |
15.5 MB |
| Cool.Flash.Games/Games/Pour The Fish Level Pack.swf |
7.6 MB |
| Cool.Flash.Games/Games/pourthefish.swf |
7.7 MB |
| Cool.Flash.Games/Games/Pragaras.swf |
12.9 MB |
| Cool.Flash.Games/Games/Pre-Civilization Stone Age.swf |
4.1 MB |
| Cool.Flash.Games/Games/pre-civilization_marble_age.swf |
6.2 MB |
| Cool.Flash.Games/Games/Pretentious Game Series/Pretentious Game 2.swf |
1.3 MB |
| Cool.Flash.Games/Games/Pretentious Game Series/Pretentious Game 5.swf |
3.3 MB |
| Cool.Flash.Games/Games/Pretentious Game Series/pretentious_game_4.swf |
2.7 MB |
| Cool.Flash.Games/Games/Pretentious Game Series/pretentiousgame.swf |
1.1 MB |
| Cool.Flash.Games/Games/Pretentious Game Series/pretentiousgame3.swf |
2.4 MB |
| Cool.Flash.Games/Games/primary.swf |
6.5 MB |
| Cool.Flash.Games/Games/prince_and_princess_elope.swf |
898 KB |
| Cool.Flash.Games/Games/princess_rescue.swf |
1.1 MB |
| Cool.Flash.Games/Games/project alnilam.swf |
7.5 MB |
| Cool.Flash.Games/Games/Project Wasteland 0.swf |
9.9 MB |
| Cool.Flash.Games/Games/Prophet.swf |
4.6 MB |
| Cool.Flash.Games/Games/Psychout.swf |
3.5 MB |
| Cool.Flash.Games/Games/purpleplanet.swf |
8.2 MB |
| Cool.Flash.Games/Games/pursuitofhat.swf |
3.6 MB |
| Cool.Flash.Games/Games/pursuitofhat2.swf |
4.8 MB |
| Cool.Flash.Games/Games/Puzzatales!.swf |
6.6 MB |
| Cool.Flash.Games/Games/Puzzle Legends.swf |
3.7 MB |
| Cool.Flash.Games/Games/pyjaman.swf |
2.4 MB |
| Cool.Flash.Games/Games/Pyro.swf |
968 KB |
| Cool.Flash.Games/Games/qcompressingtheheart.swf |
8.6 MB |
| Cool.Flash.Games/Games/quake_flash.swf |
8.6 MB |
| Cool.Flash.Games/Games/quantum_patrol.swf |
10.2 MB |
| Cool.Flash.Games/Games/quantumcorps.swf |
3.8 MB |
| Cool.Flash.Games/Games/quantumzombies.swf |
8.4 MB |
| Cool.Flash.Games/Games/questopia.swf |
10.1 MB |
| Cool.Flash.Games/Games/Quick Quests.swf |
2 MB |
| Cool.Flash.Games/Games/Quietus.swf |
11.3 MB |
| Cool.Flash.Games/Games/quietus2.swf |
5.5 MB |
| Cool.Flash.Games/Games/rabbitwantscake.swf |
1 MB |
| Cool.Flash.Games/Games/Ragdoll Cannon Series/Ragdoll Cannon 1.5.swf |
1.4 MB |
| Cool.Flash.Games/Games/Ragdoll Cannon Series/Ragdoll Cannon 2.swf |
2.8 MB |
| Cool.Flash.Games/Games/Ragdoll Cannon Series/Ragdoll Cannon Remake.swf |
1.2 MB |
| Cool.Flash.Games/Games/Ragdoll Cannon Series/ragdollcannon.swf |
966 KB |
| Cool.Flash.Games/Games/Ragdoll Cannon Series/ragdollcannon3.swf |
2.7 MB |
| Cool.Flash.Games/Games/Ragdoll Cannon Series/ragdollcannon4.swf |
3.3 MB |
| Cool.Flash.Games/Games/Ragdoll Cannon Series/ragdollcannonlevelpack.swf |
2.1 MB |
| Cool.Flash.Games/Games/ragdollachievement.swf |
5.6 MB |
| Cool.Flash.Games/Games/ragdollachievement2.swf |
8 MB |
| Cool.Flash.Games/Games/RAID Mission.swf |
10 MB |
| Cool.Flash.Games/Games/Raider Episode 1.swf |
2.5 MB |
| Cool.Flash.Games/Games/Raider Episode 2.swf |
2.4 MB |
| Cool.Flash.Games/Games/ravencrime.swf |
10.3 MB |
| Cool.Flash.Games/Games/Rawr.swf |
12.4 MB |
| Cool.Flash.Games/Games/Ray Ardent Science Ninja.swf |
11.7 MB |
| Cool.Flash.Games/Games/ray_and_cooper_2.swf |
9.5 MB |
| Cool.Flash.Games/Games/rayandcooper.swf |
3.9 MB |
| Cool.Flash.Games/Games/Raze.swf |
21.8 MB |
| Cool.Flash.Games/Games/Raze_2.swf |
15.5 MB |
| Cool.Flash.Games/Games/Raze_3.swf |
21.8 MB |
| Cool.Flash.Games/Games/reaching_finality.swf |
9.3 MB |
| Cool.Flash.Games/Games/rearmed_trials.swf |
12.9 MB |
| Cool.Flash.Games/Games/Record Tripping.swf |
10 MB |
| Cool.Flash.Games/Games/recursion.swf |
3.3 MB |
| Cool.Flash.Games/Games/Red Ball 4 (vol.1).swf |
8.8 MB |
| Cool.Flash.Games/Games/Red Ball 4 (vol.2).swf |
5.9 MB |
| Cool.Flash.Games/Games/Red Ball 4 (vol.3).swf |
5.2 MB |
| Cool.Flash.Games/Games/Red Code 2.swf |
7.9 MB |
| Cool.Flash.Games/Games/Red Code.swf |
3 MB |
| Cool.Flash.Games/Games/red remover player pack.swf |
1.3 MB |
| Cool.Flash.Games/Games/red-extinction.swf |
6.8 MB |
| Cool.Flash.Games/Games/red_ball_3.swf |
9.6 MB |
| Cool.Flash.Games/Games/red_rogue.swf |
5.3 MB |
| Cool.Flash.Games/Games/redremover.swf |
1.1 MB |
| Cool.Flash.Games/Games/redremoverplayerpack2.swf |
1.1 MB |
| Cool.Flash.Games/Games/Reincarnation Series/Reincarnation A Hillbilly Holiday.swf |
2.2 MB |
| Cool.Flash.Games/Games/Reincarnation Series/Reincarnation ADDO.swf |
4.8 MB |
| Cool.Flash.Games/Games/Reincarnation Series/Reincarnation Bloody Bayou.swf |
2.1 MB |
| Cool.Flash.Games/Games/Reincarnation Series/Reincarnation In The Name Of Evil.swf |
3.7 MB |
| Cool.Flash.Games/Games/Reincarnation Series/Reincarnation Let The Evil Times Roll.swf |
4.1 MB |
| Cool.Flash.Games/Games/Reincarnation Series/Reincarnation Out to Sea You Die.swf |
1.2 MB |
| Cool.Flash.Games/Games/Reincarnation Series/Reincarnation Riley's Out Again.swf |
2.5 MB |
| Cool.Flash.Games/Games/Reincarnation Series/Reincarnation The Backfire Of Hell.swf |
2.4 MB |
| Cool.Flash.Games/Games/Reincarnation Series/Reincarnation The Clergy Of Unholy.swf |
4.9 MB |
| Cool.Flash.Games/Games/Reincarnation Series/Reincarnation The Final Happy Hour.swf |
7.7 MB |
| Cool.Flash.Games/Games/Reincarnation Series/reincarnationallhallowsevil.swf |
2.5 MB |
| Cool.Flash.Games/Games/Reincarnation Series/reincarnationatasteofevil.swf |
3.9 MB |
| Cool.Flash.Games/Games/Reincarnation Series/reincarnationtheevilnextdoor.swf |
2.8 MB |
| Cool.Flash.Games/Games/relic.swf |
14.7 MB |
| Cool.Flash.Games/Games/relic_of_war.swf |
8.8 MB |
| Cool.Flash.Games/Games/Relive Your Life.swf |
31.3 MB |
| Cool.Flash.Games/Games/renegades.swf |
5.8 MB |
| Cool.Flash.Games/Games/retriever.swf |
5.9 MB |
| Cool.Flash.Games/Games/Retro Unicorn Attack.swf |
5.7 MB |
| Cool.Flash.Games/Games/Revenge of The Kid.swf |
13.5 MB |
| Cool.Flash.Games/Games/reverie.swf |
12.9 MB |
| Cool.Flash.Games/Games/rew.swf |
3.7 MB |
| Cool.Flash.Games/Games/rew2.swf |
7.2 MB |
| Cool.Flash.Games/Games/rich-cars-2-adrenaline-rush.swf |
7.9 MB |
| Cool.Flash.Games/Games/rich-cars.swf |
8.4 MB |
| Cool.Flash.Games/Games/richcars3hustle.swf |
13.7 MB |
| Cool.Flash.Games/Games/richmine2xmaspack.swf |
8.1 MB |
| Cool.Flash.Games/Games/Ricochet Kills Series/ricochet kills 2 players pack.swf |
2.5 MB |
| Cool.Flash.Games/Games/Ricochet Kills Series/Ricochet Kills 2.swf |
1.1 MB |
| Cool.Flash.Games/Games/Ricochet Kills Series/ricochet kills players pack.swf |
1.1 MB |
| Cool.Flash.Games/Games/Ricochet Kills Series/ricochet kills siberia.swf |
2.8 MB |
| Cool.Flash.Games/Games/Ricochet Kills Series/ricochet kills space.swf |
3 MB |
| Cool.Flash.Games/Games/Ricochet Kills Series/Ricochet Kills.swf |
747 KB |
| Cool.Flash.Games/Games/Ricochet Kills Series/ricochet Skull hunter.swf |
4.4 MB |
| Cool.Flash.Games/Games/Ricochet Kills Series/ricochet war.swf |
674 KB |
| Cool.Flash.Games/Games/Ricochet Kills Series/ricochet_kills_3.swf |
3.4 MB |
| Cool.Flash.Games/Games/Ricochet Kills Series/ricochet_kills_3_level_pack.swf |
2.9 MB |
| Cool.Flash.Games/Games/Ricochet Kills Series/ricochet_kills_4.swf |
5.8 MB |
| Cool.Flash.Games/Games/Riddle School Series/riddle_school-3.swf |
7.5 MB |
| Cool.Flash.Games/Games/Riddle School Series/riddle_school.swf |
613 KB |
| Cool.Flash.Games/Games/Riddle School Series/riddle_school_2.swf |
1.4 MB |
| Cool.Flash.Games/Games/Riddle School Series/riddle_school_4.swf |
5.9 MB |
| Cool.Flash.Games/Games/Riddle School Series/riddle_school_5.swf |
13.9 MB |
| Cool.Flash.Games/Games/riddle_transfer.swf |
14.9 MB |
| Cool.Flash.Games/Games/riddle_transfer_2.swf |
17.5 MB |
| Cool.Flash.Games/Games/Right hand.swf |
14.2 MB |
| Cool.Flash.Games/Games/rizk.swf |
9.3 MB |
| Cool.Flash.Games/Games/Road Of Fury 2.swf |
6.2 MB |
| Cool.Flash.Games/Games/road of fury.swf |
4.7 MB |
| Cool.Flash.Games/Games/Road Of Heroes.swf |
26.5 MB |
| Cool.Flash.Games/Games/Road of the Dead 2.swf |
42.7 MB |
| Cool.Flash.Games/Games/road of the dead.swf |
24.5 MB |
| Cool.Flash.Games/Games/roadkill_revenge.swf |
3.9 MB |
| Cool.Flash.Games/Games/Roads of Rome 2.swf |
4.5 MB |
| Cool.Flash.Games/Games/roads_of_rome.swf |
4.4 MB |
| Cool.Flash.Games/Games/Roads_of_Rome_3.swf |
5.1 MB |
| Cool.Flash.Games/Games/roadz.swf |
7.8 MB |
| Cool.Flash.Games/Games/Robert The Elf.swf |
18.2 MB |
| Cool.Flash.Games/Games/robinsoncrusoe.swf |
9.4 MB |
| Cool.Flash.Games/Games/Robo Trobo.swf |
8.9 MB |
| Cool.Flash.Games/Games/Robokill 2-Leviatan Five.swf |
11.9 MB |
| Cool.Flash.Games/Games/Robokill Trainer.swf |
4.9 MB |
| Cool.Flash.Games/Games/robokill_-_titan_prime.swf |
5.6 MB |
| Cool.Flash.Games/Games/robots cant think.swf |
5.3 MB |
| Cool.Flash.Games/Games/Robots Continue Work Sequence.swf |
13 MB |
| Cool.Flash.Games/Games/Rock n Risk.swf |
2.6 MB |
| Cool.Flash.Games/Games/Rocket Santa 2.swf |
3.4 MB |
| Cool.Flash.Games/Games/rocket santa.swf |
1.8 MB |
| Cool.Flash.Games/Games/RocketJump.swf |
4.7 MB |
| Cool.Flash.Games/Games/rocketpets.swf |
6.8 MB |
| Cool.Flash.Games/Games/rocketsanta.swf |
1.8 MB |
| Cool.Flash.Games/Games/rockyrider2.swf |
6.1 MB |
| Cool.Flash.Games/Games/rogue-soul.swf |
5.3 MB |
| Cool.Flash.Games/Games/rogue_soul_2.swf |
9 MB |
| Cool.Flash.Games/Games/roll_roll_pirate.swf |
5.8 MB |
| Cool.Flash.Games/Games/rollintot.swf |
3.1 MB |
| Cool.Flash.Games/Games/Roly-Poly Series/Roly-Poly Cannon 3.swf |
4.2 MB |
| Cool.Flash.Games/Games/Roly-Poly Series/Roly-Poly Cannon Bloody Monsters Pack.swf |
4.6 MB |
| Cool.Flash.Games/Games/Roly-Poly Series/ROLY-POLY Eliminator.swf |
2.5 MB |
| Cool.Flash.Games/Games/Roly-Poly Series/Roly-Poly Monsters.swf |
4 MB |
| Cool.Flash.Games/Games/Roly-Poly Series/roly-poly_cannon_bloody_monsters_pack_2.swf |
6.2 MB |
| Cool.Flash.Games/Games/Roly-Poly Series/roly-polycannon2.swf |
4 MB |
| Cool.Flash.Games/Games/Roly-Poly Series/rolypolyeliminator2.swf |
5.2 MB |
| Cool.Flash.Games/Games/rot gut.swf |
5.8 MB |
| Cool.Flash.Games/Games/Rotate & Roll Players Pack.swf |
963 KB |
| Cool.Flash.Games/Games/Rotate & Roll.swf |
911 KB |
| Cool.Flash.Games/Games/roundworld.swf |
1.6 MB |
| Cool.Flash.Games/Games/Royal Protectors.swf |
12.6 MB |
| Cool.Flash.Games/Games/royal_heroes.swf |
15.2 MB |
| Cool.Flash.Games/Games/royal_warfare.swf |
13.4 MB |
| Cool.Flash.Games/Games/royal_warfare_2.swf |
15.8 MB |
| Cool.Flash.Games/Games/royaloffense.swf |
9.8 MB |
| Cool.Flash.Games/Games/royalsquad.swf |
12.8 MB |
| Cool.Flash.Games/Games/Rumble in the Soup.swf |
15 MB |
| Cool.Flash.Games/Games/run2livegreatescape.swf |
7.2 MB |
| Cool.Flash.Games/Games/Run3.swf |
12.2 MB |
| Cool.Flash.Games/Games/run_1.swf |
1.4 MB |
| Cool.Flash.Games/Games/run_2.swf |
891 KB |
| Cool.Flash.Games/Games/run_2_live.swf |
6.6 MB |
| Cool.Flash.Games/Games/run_ninja_run_-_unexpected_road.swf |
4.8 MB |
| Cool.Flash.Games/Games/running_fred_lite.swf |
8.9 MB |
| Cool.Flash.Games/Games/rupertszombiediary.swf |
10.2 MB |
| Cool.Flash.Games/Games/ruthless_pandas.swf |
5.3 MB |
| Cool.Flash.Games/Games/s_t_a_n_d.swf |
4.5 MB |
| Cool.Flash.Games/Games/Sacred Heroes.swf |
8.1 MB |
| Cool.Flash.Games/Games/sacred_treasure.swf |
15.5 MB |
| Cool.Flash.Games/Games/sandsofdoom.swf |
7.7 MB |
| Cool.Flash.Games/Games/sandsofthecoliseum.swf |
10.2 MB |
| Cool.Flash.Games/Games/sanguine.swf |
5.6 MB |
| Cool.Flash.Games/Games/sanguine_2.swf |
17.2 MB |
| Cool.Flash.Games/Games/Santa rockstar series/Santa Rockstar Metal Xmas 2.swf |
9.9 MB |
| Cool.Flash.Games/Games/Santa rockstar series/Santa Rockstar Metal Xmas 3.swf |
19 MB |
| Cool.Flash.Games/Games/Santa rockstar series/Santa Rockstar Metal Xmas 4.swf |
16.3 MB |
| Cool.Flash.Games/Games/Santa rockstar series/Santa Rockstar Metal Xmas.swf |
9 MB |
| Cool.Flash.Games/Games/santa run 2.swf |
2.8 MB |
| Cool.Flash.Games/Games/santa run 3.swf |
4.1 MB |
| Cool.Flash.Games/Games/Sapphire Room Escape.swf |
2.2 MB |
| Cool.Flash.Games/Games/sas zombie assault 2.swf |
3.8 MB |
| Cool.Flash.Games/Games/SAS Zombie Assault.swf |
2 MB |
| Cool.Flash.Games/Games/sas_zombie_assault_2_-_insane_asylum.swf |
4.5 MB |
| Cool.Flash.Games/Games/Save To Kill.swf |
19.8 MB |
| Cool.Flash.Games/Games/savethefallen.swf |
1.4 MB |
| Cool.Flash.Games/Games/saving the company.swf |
5.5 MB |
| Cool.Flash.Games/Games/screwthenut.swf |
1.3 MB |
| Cool.Flash.Games/Games/Searching for the Elephant.swf |
5.8 MB |
| Cool.Flash.Games/Games/seed of destruction.swf |
9.6 MB |
| Cool.Flash.Games/Games/seedling.swf |
7.5 MB |
| Cool.Flash.Games/Games/sentry_knight_conquest.swf |
10.4 MB |
| Cool.Flash.Games/Games/sentryknight.swf |
15.1 MB |
| Cool.Flash.Games/Games/sentryknight2.swf |
19.9 MB |
| Cool.Flash.Games/Games/senya_and_oscar_the_fearless_adventure.swf |
3.8 MB |
| Cool.Flash.Games/Games/SeppuKuties.swf |
1.4 MB |
| Cool.Flash.Games/Games/sequester.swf |
10 MB |
| Cool.Flash.Games/Games/Shadez 3 The Moon Miners.swf |
4.4 MB |
| Cool.Flash.Games/Games/Shadez The Black Operations.swf |
692 KB |
| Cool.Flash.Games/Games/shadez_2_battle_for_earth.swf |
3 MB |
| Cool.Flash.Games/Games/shadow regiment.swf |
5.1 MB |
| Cool.Flash.Games/Games/shadowless.swf |
9.7 MB |
| Cool.Flash.Games/Games/Shameless clone 2.swf |
3.7 MB |
| Cool.Flash.Games/Games/shameless_clone.swf |
2 MB |
| Cool.Flash.Games/Games/shape_fold_animals.swf |
3.8 MB |
| Cool.Flash.Games/Games/shapefold.swf |
1 MB |
| Cool.Flash.Games/Games/shapefold2.swf |
2.1 MB |
| Cool.Flash.Games/Games/shapeshifter2.swf |
10.1 MB |
| Cool.Flash.Games/Games/Shark Series/los_angeles_shark.swf |
9.5 MB |
| Cool.Flash.Games/Games/Shark Series/medieval shark.swf |
8.7 MB |
| Cool.Flash.Games/Games/Shark Series/miamishark.swf |
3.3 MB |
| Cool.Flash.Games/Games/Shark Series/newyorkshark.swf |
11.5 MB |
| Cool.Flash.Games/Games/Shark Series/prehistoricshark.swf |
15.5 MB |
| Cool.Flash.Games/Games/Shark Series/sydneyshark.swf |
8.6 MB |
| Cool.Flash.Games/Games/shark_lifting_2.swf |
29.6 MB |
| Cool.Flash.Games/Games/sharp_trigger.swf |
3.9 MB |
| Cool.Flash.Games/Games/sheriffchase.swf |
3.1 MB |
| Cool.Flash.Games/Games/Sherlock Holmes - The Tea Shop Murder Mystery.swf |
4.1 MB |
| Cool.Flash.Games/Games/Sherlock Holmes 2.swf |
8.5 MB |
| Cool.Flash.Games/Games/Shift Series/Alt Shift Lite Edition.swf |
6.1 MB |
| Cool.Flash.Games/Games/Shift Series/SHIFT 2.swf |
1.8 MB |
| Cool.Flash.Games/Games/Shift Series/SHIFT 3.swf |
1005 KB |
| Cool.Flash.Games/Games/Shift Series/shift freedom.swf |
7.3 MB |
| Cool.Flash.Games/Games/Shift Series/SHIFT.swf |
239 KB |
| Cool.Flash.Games/Games/Shift Series/shift_4.swf |
3.4 MB |
| Cool.Flash.Games/Games/Shifter.swf |
3.9 MB |
| Cool.Flash.Games/Games/shoctrooper.swf |
16 MB |
| Cool.Flash.Games/Games/shoot-out_in_the_west.swf |
16.3 MB |
| Cool.Flash.Games/Games/shorties_s_kingdom 2.swf |
6 MB |
| Cool.Flash.Games/Games/Shorty Covers.swf |
2.5 MB |
| Cool.Flash.Games/Games/Shotfirer.swf |
6.6 MB |
| Cool.Flash.Games/Games/Shotgun_vs_Zombies.swf |
6.8 MB |
| Cool.Flash.Games/Games/Sichiken.swf |
8.9 MB |
| Cool.Flash.Games/Games/Siege Hero Pirate Pillage.swf |
9.1 MB |
| Cool.Flash.Games/Games/siege hero viking vengeance.swf |
7.5 MB |
| Cool.Flash.Games/Games/siegeknight.swf |
8.2 MB |
| Cool.Flash.Games/Games/Sieger Series/sieger.swf |
4.4 MB |
| Cool.Flash.Games/Games/Sieger Series/sieger_-_level_pack.swf |
7.2 MB |
| Cool.Flash.Games/Games/Sieger Series/sieger_2_age_of_gunpowder.swf |
6.9 MB |
| Cool.Flash.Games/Games/Sieger Series/sieger_rebuilt_to_destroy.swf |
7.4 MB |
| Cool.Flash.Games/Games/siegius_arena.swf |
8.6 MB |
| Cool.Flash.Games/Games/sierra_7.swf |
28.5 MB |
| Cool.Flash.Games/Games/Sift Heads Series/Sift Heads 0.swf |
2.1 MB |
| Cool.Flash.Games/Games/Sift Heads Series/Sift Heads World Act 7 - Ultimatum.swf |
7.5 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads.swf |
2.9 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_1_remasterized.swf |
8.4 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_2.swf |
3.4 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_3.swf |
1.8 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_4.swf |
4.6 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_5.swf |
3.8 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_assault.swf |
2.8 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_assault_2.swf |
3.4 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_assault_3.swf |
4 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_cartels_-_act_1.swf |
7.7 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_cartels_-_act_2.swf |
5.8 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_cartels_-_act_3.swf |
11.2 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_street_wars_prologue.swf |
9.3 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_ultimatum.swf |
8.2 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_world-act_6.swf |
6.6 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_world_act_1.swf |
5.3 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_world_act_2.swf |
5.7 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_world_act_3.swf |
5.9 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_world_act_4.swf |
7.4 MB |
| Cool.Flash.Games/Games/Sift Heads Series/sift_heads_world_act_5.swf |
7.7 MB |
| Cool.Flash.Games/Games/sift_renegade.swf |
4.2 MB |
| Cool.Flash.Games/Games/sift_renegade_2.swf |
3 MB |
| Cool.Flash.Games/Games/sift_renegade_3.swf |
3.9 MB |
| Cool.Flash.Games/Games/sift_renegade_3_expansion_defiance.swf |
4.2 MB |
| Cool.Flash.Games/Games/siftx-mess.swf |
1.3 MB |
| Cool.Flash.Games/Games/simplemotions.swf |
888 KB |
| Cool.Flash.Games/Games/simplemotions2.swf |
2.1 MB |
| Cool.Flash.Games/Games/sketch_quest.swf |
9.2 MB |
| Cool.Flash.Games/Games/ski_safari.swf |
9.8 MB |
| Cool.Flash.Games/Games/skinny.swf |
9.5 MB |
| Cool.Flash.Games/Games/Skip Around the World Finland Suomi.swf |
11.2 MB |
| Cool.Flash.Games/Games/Skip Around the World - India.swf |
11.7 MB |
| Cool.Flash.Games/Games/skullface.swf |
8.4 MB |
| Cool.Flash.Games/Games/Skullz.swf |
16.1 MB |
| Cool.Flash.Games/Games/Sky Island.swf |
1.2 MB |
| Cool.Flash.Games/Games/skydefenderjoesstory.swf |
16 MB |
| Cool.Flash.Games/Games/skypanda.swf |
14.2 MB |
| Cool.Flash.Games/Games/skyquest.swf |
10.6 MB |
| Cool.Flash.Games/Games/Slime Quest.swf |
5.7 MB |
| Cool.Flash.Games/Games/Slime's Turn.swf |
3.9 MB |
| Cool.Flash.Games/Games/slime-laboratory.swf |
1.3 MB |
| Cool.Flash.Games/Games/slime_laboratory_2.swf |
1.3 MB |
| Cool.Flash.Games/Games/Slimey's Quest.swf |
1.5 MB |
| Cool.Flash.Games/Games/sling.swf |
3.7 MB |
| Cool.Flash.Games/Games/slingfire.swf |
3.8 MB |
| Cool.Flash.Games/Games/slowandblow.swf |
5.1 MB |
| Cool.Flash.Games/Games/slumdog_billionaire.swf |
4.6 MB |
| Cool.Flash.Games/Games/slush invaders game.swf |
9.4 MB |
| Cool.Flash.Games/Games/Small Arms War.swf |
3.5 MB |
| Cool.Flash.Games/Games/Smash_Palace.swf |
11.8 MB |
| Cool.Flash.Games/Games/Smells Like Art.swf |
12.3 MB |
| Cool.Flash.Games/Games/smile_pixel.swf |
1.4 MB |
| Cool.Flash.Games/Games/Smokin Barrels 2.swf |
4.8 MB |
| Cool.Flash.Games/Games/smokinbarrels.swf |
996 KB |
| Cool.Flash.Games/Games/Snail Bob Series/snail_bob.swf |
4.3 MB |
| Cool.Flash.Games/Games/Snail Bob Series/snail_bob_2.swf |
5.8 MB |
| Cool.Flash.Games/Games/Snail Bob Series/snail_bob_3.swf |
7.4 MB |
| Cool.Flash.Games/Games/Snail Bob Series/snail_bob_4_space.swf |
6 MB |
| Cool.Flash.Games/Games/Snail Bob Series/snail_bob_5 love story.swf |
9.3 MB |
| Cool.Flash.Games/Games/Snail Bob Series/snail_bob_6_winter_story.swf |
9.5 MB |
| Cool.Flash.Games/Games/Snail Bob Series/snail_bob_7_fantasy_story.swf |
8.2 MB |
| Cool.Flash.Games/Games/Snail Bob Series/snail_bob_8 Island Story.swf |
11.6 MB |
| Cool.Flash.Games/Games/snakesquad.swf |
4.2 MB |
| Cool.Flash.Games/Games/Sneak Thief Series/Sneak Thief Triple Trouble.swf |
2.5 MB |
| Cool.Flash.Games/Games/Sneak Thief Series/Sneak Thief - prime catch.swf |
2.6 MB |
| Cool.Flash.Games/Games/Sneak Thief Series/Sneak Thief 2.swf |
2.2 MB |
| Cool.Flash.Games/Games/Sneak Thief Series/Sneak Thief 4.swf |
6.2 MB |
| Cool.Flash.Games/Games/Sneak Thief Series/Sneak Thief 5.swf |
6.2 MB |
| Cool.Flash.Games/Games/snowdrift.swf |
5.2 MB |
| Cool.Flash.Games/Games/soda_dungeon_lite.swf |
42.6 MB |
| Cool.Flash.Games/Games/solclockworkpart1.swf |
8.8 MB |
| Cool.Flash.Games/Games/soldierdiary.swf |
2.2 MB |
| Cool.Flash.Games/Games/Solipskier.swf |
3.8 MB |
| Cool.Flash.Games/Games/Sonny.swf |
9.3 MB |
| Cool.Flash.Games/Games/Sonny_2.swf |
20.3 MB |
| Cool.Flash.Games/Games/soom.swf |
5.2 MB |
| Cool.Flash.Games/Games/SOPAPIPA.swf |
1.2 MB |
| Cool.Flash.Games/Games/Sota.swf |
5.7 MB |
| Cool.Flash.Games/Games/Space Incident.swf |
5.5 MB |
| Cool.Flash.Games/Games/Space is Key Christmas.swf |
4.6 MB |
| Cool.Flash.Games/Games/space oddity 2.swf |
4.5 MB |
| Cool.Flash.Games/Games/space oddity.swf |
4.2 MB |
| Cool.Flash.Games/Games/spaceiskey.swf |
997 KB |
| Cool.Flash.Games/Games/spaceiskey2.swf |
2.3 MB |
| Cool.Flash.Games/Games/spaceship.swf |
3.7 MB |
| Cool.Flash.Games/Games/specter_knight.swf |
18.2 MB |
| Cool.Flash.Games/Games/speedrunner.swf |
11.2 MB |
| Cool.Flash.Games/Games/spikealovestory.swf |
2.6 MB |
| Cool.Flash.Games/Games/Splat.swf |
1.3 MB |
| Cool.Flash.Games/Games/splitman.swf |
1.2 MB |
| Cool.Flash.Games/Games/splitterpals.swf |
1.3 MB |
| Cool.Flash.Games/Games/Sprout.swf |
1.1 MB |
| Cool.Flash.Games/Games/Spy 2.swf |
2.3 MB |
| Cool.Flash.Games/Games/spy car.swf |
9.3 MB |
| Cool.Flash.Games/Games/Spy.swf |
794 KB |
| Cool.Flash.Games/Games/square_hero_origins.swf |
2.3 MB |
| Cool.Flash.Games/Games/stackopolis.swf |
1.2 MB |
| Cool.Flash.Games/Games/star_cars.swf |
8.5 MB |
| Cool.Flash.Games/Games/StarShine 2.swf |
948 KB |
| Cool.Flash.Games/Games/starshine.swf |
369 KB |
| Cool.Flash.Games/Games/state_of_zombies_2.swf |
3.6 MB |
| Cool.Flash.Games/Games/state_of_zombies_3.swf |
7.4 MB |
| Cool.Flash.Games/Games/stealth_bound.swf |
9.4 MB |
| Cool.Flash.Games/Games/stealth_bound_level_pack.swf |
10.4 MB |
| Cool.Flash.Games/Games/stealth_hunter.swf |
1.2 MB |
| Cool.Flash.Games/Games/stealth_hunter_2.swf |
7.8 MB |
| Cool.Flash.Games/Games/steampunktower.swf |
15.7 MB |
| Cool.Flash.Games/Games/Stellar Squad.swf |
22.7 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_1_episode_1.swf |
1.5 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_1_episode_2.swf |
1.6 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_1_episode_3.swf |
1.9 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_1_episode_4.swf |
1.6 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_2_episode_1.swf |
1.5 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_2_episode_2.swf |
1.6 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_2_episode_3.swf |
1.6 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_2_episode_4.swf |
1.8 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_3_episode_1.swf |
1.7 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_3_episode_2.swf |
1.7 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_3_episode_3.swf |
1.6 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_3_episode_4.swf |
1.6 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_4_episode_1.swf |
1.7 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_4_episode_2.swf |
1.6 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_4_episode_3.swf |
1.7 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_4_episode_4.swf |
1.7 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_5_episode_1.swf |
1.8 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_5_episode_2.swf |
1.9 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_5_episode_3.swf |
1.8 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_5_episode_4.swf |
2 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_6_episode_1.swf |
2.2 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_6_episode_2.swf |
2.1 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_6_episode_3.swf |
2.1 MB |
| Cool.Flash.Games/Games/Steppenwolf Series/steppenwolf_chapter_6_episode_4.swf |
2.6 MB |
| Cool.Flash.Games/Games/Stick of Death 2.swf |
3.4 MB |
| Cool.Flash.Games/Games/Stick of Death.swf |
7.1 MB |
| Cool.Flash.Games/Games/Stick Squad 2.swf |
15.5 MB |
| Cool.Flash.Games/Games/stick_squad.swf |
17.6 MB |
| Cool.Flash.Games/Games/stick_squad_3.swf |
14.8 MB |
| Cool.Flash.Games/Games/stick_squad_4.swf |
19.8 MB |
| Cool.Flash.Games/Games/sticky_ninja_academy.swf |
4.6 MB |
| Cool.Flash.Games/Games/storm_ops_3.swf |
11.4 MB |
| Cool.Flash.Games/Games/StormWinds. The Mary Reed Chronicles.swf |
5.2 MB |
| Cool.Flash.Games/Games/stormy_castle.swf |
10.2 MB |
| Cool.Flash.Games/Games/Strike Force Heroes 3.swf |
18.5 MB |
| Cool.Flash.Games/Games/strike_force_heroes_2.swf |
15.6 MB |
| Cool.Flash.Games/Games/StrikeForce Kitty Series/strikeforce_kitty.swf |
3.7 MB |
| Cool.Flash.Games/Games/StrikeForce Kitty Series/strikeforce_kitty_2.swf |
10.7 MB |
| Cool.Flash.Games/Games/StrikeForce Kitty Series/strikeforce_kitty_last_stand.swf |
5.3 MB |
| Cool.Flash.Games/Games/StrikeForce Kitty Series/strikeforce_kitty_league.swf |
6 MB |
| Cool.Flash.Games/Games/strikeforceheroes.swf |
17.8 MB |
| Cool.Flash.Games/Games/stupidella.swf |
8 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine 0 the ancient adventure.swf |
1.3 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine 1 the basement.swf |
1.6 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine 10 the Exit.swf |
29 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine 2 the lighthouse.swf |
5.1 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine 32 chambers.swf |
2.6 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine 5 the root.swf |
2.3 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine 6 the edge.swf |
3.1 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine 7 the Core.swf |
5.5 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine 8 the Plan.swf |
6.8 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine 9 the Temple.swf |
9.2 MB |
| Cool.Flash.Games/Games/Submachine Series/Submachine FLF.swf |
2.7 MB |
| Cool.Flash.Games/Games/Submachine Series/submachine4-thelab.swf |
3.6 MB |
| Cool.Flash.Games/Games/Submachine Series/submachine7.swf |
5.4 MB |
| Cool.Flash.Games/Games/Sugar, Sugar - The Christmas Special.swf |
3.5 MB |
| Cool.Flash.Games/Games/Sugar, Sugar 3.swf |
1.1 MB |
| Cool.Flash.Games/Games/sugar_sugar.swf |
860 KB |
| Cool.Flash.Games/Games/Sugar_Sugar_2.swf |
890 KB |
| Cool.Flash.Games/Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe.swf |
1.1 MB |
| Cool.Flash.Games/Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe_2.swf |
5.5 MB |
| Cool.Flash.Games/Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe_3.swf |
9.2 MB |
| Cool.Flash.Games/Games/Super Crazy Guitar Maniac Deluxe Series/super_crazy_guitar_maniac_deluxe_4.swf |
13.6 MB |
| Cool.Flash.Games/Games/Super Mario 63.swf |
10.6 MB |
| Cool.Flash.Games/Games/SUPER SMASH FLASH.swf |
8.4 MB |
| Cool.Flash.Games/Games/Super Sneak.swf |
5.9 MB |
| Cool.Flash.Games/Games/Super Stacker 2.swf |
1.4 MB |
| Cool.Flash.Games/Games/super-mega-bot.swf |
5.3 MB |
| Cool.Flash.Games/Games/super_adventure_pals.swf |
14.4 MB |
| Cool.Flash.Games/Games/super_battle_city.swf |
9.1 MB |
| Cool.Flash.Games/Games/super_castle_sprint.swf |
11.7 MB |
| Cool.Flash.Games/Games/super_chibi_knight.swf |
49 MB |
| Cool.Flash.Games/Games/super_house_of_dead_ninjas.swf |
17.1 MB |
| Cool.Flash.Games/Games/super_muzhik_2.swf |
5.8 MB |
| Cool.Flash.Games/Games/super_squad.swf |
4.5 MB |
| Cool.Flash.Games/Games/superpig.swf |
1.3 MB |
| Cool.Flash.Games/Games/superpuzzleplatformer.swf |
5 MB |
| Cool.Flash.Games/Games/supersantabomber.swf |
5.8 MB |
| Cool.Flash.Games/Games/superstrikeofrage.swf |
955 KB |
| Cool.Flash.Games/Games/supervillainy.swf |
3.3 MB |
| Cool.Flash.Games/Games/Survivor115.swf |
936 KB |
| Cool.Flash.Games/Games/Sushi Cat Series/sushi_cat.swf |
4.6 MB |
| Cool.Flash.Games/Games/Sushi Cat Series/sushi_cat_2.swf |
6.8 MB |
| Cool.Flash.Games/Games/Sushi Cat Series/sushi_cat_the_honeymoon.swf |
6.4 MB |
| Cool.Flash.Games/Games/Sushi Cat Series/sushicat2thegreatpurrade.swf |
7.8 MB |
| Cool.Flash.Games/Games/sushicatapult.swf |
17 MB |
| Cool.Flash.Games/Games/Suspense II.swf |
5.2 MB |
| Cool.Flash.Games/Games/Suspense.swf |
3.6 MB |
| Cool.Flash.Games/Games/swarm_queen.swf |
7.5 MB |
| Cool.Flash.Games/Games/Sweet Drmzzz.swf |
1.9 MB |
| Cool.Flash.Games/Games/swiftturn2.swf |
5 MB |
| Cool.Flash.Games/Games/Swords and Souls.swf |
8.2 MB |
| Cool.Flash.Games/Games/Symbiosis Greenland.swf |
9.9 MB |
| Cool.Flash.Games/Games/Symon.swf |
19.8 MB |
| Cool.Flash.Games/Games/Tactical Assassin Mobile.swf |
22.9 MB |
| Cool.Flash.Games/Games/Tactics 100 Live.swf |
898 KB |
| Cool.Flash.Games/Games/Tainted Olive - Chapter 1.swf |
7.6 MB |
| Cool.Flash.Games/Games/Tainted Olive - Chapter 2.swf |
13.5 MB |
| Cool.Flash.Games/Games/Take Something Literally 2.swf |
742 KB |
| Cool.Flash.Games/Games/Take Something Literally.swf |
358 KB |
| Cool.Flash.Games/Games/takeover.swf |
15.7 MB |
| Cool.Flash.Games/Games/Tales of Carmelot - The Missing Pot of Gold.swf |
9.9 MB |
| Cool.Flash.Games/Games/Talesworth Adventure Ep. 1.swf |
576 KB |
| Cool.Flash.Games/Games/Talesworth Arena.swf |
4.6 MB |
| Cool.Flash.Games/Games/talesworthadventurethelostartifacts.swf |
5 MB |
| Cool.Flash.Games/Games/Tammy Jo Superstar.swf |
11.5 MB |
| Cool.Flash.Games/Games/tavern_of_heroes.swf |
14.4 MB |
| Cool.Flash.Games/Games/Tealy Orangey.swf |
138 KB |
| Cool.Flash.Games/Games/Teddys Excellent Adventure.swf |
7 MB |
| Cool.Flash.Games/Games/Temple of the Spear.swf |
5.3 MB |
| Cool.Flash.Games/Games/Tequila Zombies 3.swf |
34.7 MB |
| Cool.Flash.Games/Games/Tequila Zombies.swf |
4.5 MB |
| Cool.Flash.Games/Games/Tequila_Zombies_2.swf |
12.8 MB |
| Cool.Flash.Games/Games/teslawarofcurrents.swf |
7 MB |
| Cool.Flash.Games/Games/TETRIS'D The Game.swf |
418 KB |
| Cool.Flash.Games/Games/thanksforplaying.swf |
1.1 MB |
| Cool.Flash.Games/Games/That red button..swf |
14.2 MB |
| Cool.Flash.Games/Games/the adventures of dear explorer.swf |
6.3 MB |
| Cool.Flash.Games/Games/The Adventures of Zomboy.swf |
2.5 MB |
| Cool.Flash.Games/Games/The Body.swf |
9.1 MB |
| Cool.Flash.Games/Games/The Book of Living Magic.swf |
8.5 MB |
| Cool.Flash.Games/Games/The Case of the Mysteriously Missing Hat.swf |
20 MB |
| Cool.Flash.Games/Games/The Cave of Ātman.swf |
12.2 MB |
| Cool.Flash.Games/Games/The Dreamerz.swf |
5.7 MB |
| Cool.Flash.Games/Games/The Elephant Collection/Achievement Unlocked 2.swf |
3.2 MB |
| Cool.Flash.Games/Games/The Elephant Collection/Achievement Unlocked 3.swf |
2 MB |
| Cool.Flash.Games/Games/The Elephant Collection/Achievement Unlocked.swf |
2.4 MB |
| Cool.Flash.Games/Games/The Elephant Collection/elephant_quest.swf |
3.5 MB |
| Cool.Flash.Games/Games/The Elephant Collection/Obey the Game.swf |
939 KB |
| Cool.Flash.Games/Games/The Elephant Collection/this-is-the-only-level 3.swf |
1.7 MB |
| Cool.Flash.Games/Games/The Elephant Collection/this-is-the-only-level 4.swf |
4.6 MB |
| Cool.Flash.Games/Games/The Elephant Collection/this-is-the-only-level-too.swf |
1.8 MB |
| Cool.Flash.Games/Games/The Elephant Collection/This_is_the_only_level.swf |
1.3 MB |
| Cool.Flash.Games/Games/The Enchanted Cave 2.swf |
14.4 MB |
| Cool.Flash.Games/Games/The Enchanted Cave.swf |
5.9 MB |
| Cool.Flash.Games/Games/The Everloom.swf |
4.8 MB |
| Cool.Flash.Games/Games/The Fabulous Screech.swf |
12 MB |
| Cool.Flash.Games/Games/The Fancy Pants Adventure World Series/The Fancy Pants Adventure World 2.swf |
9.3 MB |
| Cool.Flash.Games/Games/The Fancy Pants Adventure World Series/The Fancy Pants Adventure World 3.swf |
31.6 MB |
| Cool.Flash.Games/Games/The Fancy Pants Adventure World Series/The fancy_pants_adventure_world_1.swf |
1.6 MB |
| Cool.Flash.Games/Games/The Farm.swf |
6.2 MB |
| Cool.Flash.Games/Games/The Fog Fall 2.swf |
6.5 MB |
| Cool.Flash.Games/Games/The Fog Fall 3.swf |
10.4 MB |
| Cool.Flash.Games/Games/The Fog Fall 4.swf |
7.6 MB |
| Cool.Flash.Games/Games/The Fog Fall.swf |
3.5 MB |
| Cool.Flash.Games/Games/The Gatekeeper.swf |
17.8 MB |
| Cool.Flash.Games/Games/The Gentleman.swf |
4.5 MB |
| Cool.Flash.Games/Games/The great Attic Escape.swf |
2.3 MB |
| Cool.Flash.Games/Games/The Great Basement Escape.swf |
2.1 MB |
| Cool.Flash.Games/Games/The Great Bazooki.swf |
6.6 MB |
| Cool.Flash.Games/Games/The Great House Escape.swf |
5.9 MB |
| Cool.Flash.Games/Games/The Great Kitchen Escape.swf |
1.3 MB |
| Cool.Flash.Games/Games/the great living room escape.swf |
1.8 MB |
| Cool.Flash.Games/Games/The Great Minimum.swf |
1.1 MB |
| Cool.Flash.Games/Games/The Grey Rainbow.swf |
9.8 MB |
| Cool.Flash.Games/Games/The Guardian Chapter 2 Lantern Of Nightmares.swf |
9.2 MB |
| Cool.Flash.Games/Games/The Guardian. Chapter 1.swf |
3.5 MB |
| Cool.Flash.Games/Games/The Henry Stickmen Collection/breaking_the_bank.swf |
3 MB |
| Cool.Flash.Games/Games/The Henry Stickmen Collection/escaping_the_prison.swf |
9.3 MB |
| Cool.Flash.Games/Games/The Henry Stickmen Collection/fleeing_the_complex.swf |
32.9 MB |
| Cool.Flash.Games/Games/The Henry Stickmen Collection/infiltrating_the_airship.swf |
28.4 MB |
| Cool.Flash.Games/Games/The Henry Stickmen Collection/stealing the diamond.swf |
13.9 MB |
| Cool.Flash.Games/Games/The Impossible Quiz - Fan Edition.swf |
3.4 MB |
| Cool.Flash.Games/Games/The Impossible Quiz 2.swf |
9.4 MB |
| Cool.Flash.Games/Games/The irRegularGame of Life.swf |
569 KB |
| Cool.Flash.Games/Games/The Last Door Series/The Last Door - Chapter 1 The Letter.swf |
15.7 MB |
| Cool.Flash.Games/Games/The Last Door Series/The Last Door - Chapter 2 Memories.swf |
18.9 MB |
| Cool.Flash.Games/Games/The Last Door Series/The Last Door - Chapter 3 The Four Witnesses.swf |
19.5 MB |
| Cool.Flash.Games/Games/The Last Door Series/The Last Door - Chapter 4 Ancient Shadows.swf |
14.1 MB |
| Cool.Flash.Games/Games/The Last Door Series/The Last Door Prologue.swf |
7.8 MB |
| Cool.Flash.Games/Games/The last stand - Union sity.swf |
18.9 MB |
| Cool.Flash.Games/Games/The Last Stand 2.swf |
8.4 MB |
| Cool.Flash.Games/Games/The Linear RPG.swf |
64 KB |
| Cool.Flash.Games/Games/The Lonely Square.swf |
16.7 MB |
| Cool.Flash.Games/Games/The Majesty of Colors.swf |
887 KB |
| Cool.Flash.Games/Games/the mechanicer.swf |
1.7 MB |
| Cool.Flash.Games/Games/the miller estate/EPISODE3.swf |
925 KB |
| Cool.Flash.Games/Games/the miller estate/EPISODE4FIXED.swf |
1.7 MB |
| Cool.Flash.Games/Games/the miller estate/INTRODUCTION.swf |
421 KB |
| Cool.Flash.Games/Games/the miller estate/the_miller_estate.swf |
1.5 MB |
| Cool.Flash.Games/Games/the miller estate/the_miller_estate_2.swf |
1005 KB |
| Cool.Flash.Games/Games/The Next Floor.swf |
5.6 MB |
| Cool.Flash.Games/Games/The Railway Robots Road Trip.swf |
2.1 MB |
| Cool.Flash.Games/Games/The Sagittarian Series/the sagittarian 2.swf |
9.2 MB |
| Cool.Flash.Games/Games/The Sagittarian Series/The Sagittarian 3.swf |
7.4 MB |
| Cool.Flash.Games/Games/The Sagittarian Series/The Sagittarian 4 Bayou.swf |
4.6 MB |
| Cool.Flash.Games/Games/The Sagittarian Series/The Sagittarian 4 Berger.swf |
17.8 MB |
| Cool.Flash.Games/Games/The Sagittarian Series/The Sagittarian.swf |
2.1 MB |
| Cool.Flash.Games/Games/The Scene of the Crime Dream of Murder.swf |
4.9 MB |
| Cool.Flash.Games/Games/the scene of the crime golden doll.swf |
9 MB |
| Cool.Flash.Games/Games/the scene of the crime.swf |
5.3 MB |
| Cool.Flash.Games/Games/The Scorpion Box.swf |
5.6 MB |
| Cool.Flash.Games/Games/The Several Journeys of Reemus Chapter 1.swf |
12.3 MB |
| Cool.Flash.Games/Games/The Several Journeys of Reemus Chapter 2.swf |
7.6 MB |
| Cool.Flash.Games/Games/The Several Journeys of Reemus Chapter 3.swf |
8.8 MB |
| Cool.Flash.Games/Games/The Several Journeys of Reemus Chapter 4.swf |
8 MB |
| Cool.Flash.Games/Games/The Sniper 2.swf |
5.4 MB |
| Cool.Flash.Games/Games/the sniper.swf |
2.1 MB |
| Cool.Flash.Games/Games/The Square.swf |
1.3 MB |
| Cool.Flash.Games/Games/The Story of Brewster Chipptooth.swf |
11.2 MB |
| Cool.Flash.Games/Games/The Sun for The Vampire.swf |
7.2 MB |
| Cool.Flash.Games/Games/The Trader of Stories.swf |
5.5 MB |
| Cool.Flash.Games/Games/The Valley Rule.swf |
4.9 MB |
| Cool.Flash.Games/Games/the-day.swf |
1.9 MB |
| Cool.Flash.Games/Games/the-gun-game-2.swf |
5.7 MB |
| Cool.Flash.Games/Games/the-illusionists-dream.swf |
3.3 MB |
| Cool.Flash.Games/Games/the_bank_robber.swf |
7.8 MB |
| Cool.Flash.Games/Games/the_bearbarians.swf |
6.9 MB |
| Cool.Flash.Games/Games/the_bravest_hunter.swf |
23.1 MB |
| Cool.Flash.Games/Games/the_breach.swf |
8.7 MB |
| Cool.Flash.Games/Games/the_evening_of_the_son.swf |
7.3 MB |
| Cool.Flash.Games/Games/the_great_bathroom_escape.swf |
2.6 MB |
| Cool.Flash.Games/Games/the_gun_game_redux.swf |
5.1 MB |
| Cool.Flash.Games/Games/the_i_of_it.swf |
2.1 MB |
| Cool.Flash.Games/Games/the_keeper_of_4_elements.swf |
10 MB |
| Cool.Flash.Games/Games/the_last_dinosaurs.swf |
15.5 MB |
| Cool.Flash.Games/Games/the_last_stand.swf |
4.3 MB |
| Cool.Flash.Games/Games/The_Peacekeeper.swf |
6.3 MB |
| Cool.Flash.Games/Games/the_power_of_love.swf |
1.8 MB |
| Cool.Flash.Games/Games/the_pretender_part_one.swf |
5.1 MB |
| Cool.Flash.Games/Games/the_pretender_part_three.swf |
9.4 MB |
| Cool.Flash.Games/Games/the_pretender_part_two.swf |
5.6 MB |
| Cool.Flash.Games/Games/the_prince_edward.swf |
8.9 MB |
| Cool.Flash.Games/Games/the_royal_archers.swf |
7.9 MB |
| Cool.Flash.Games/Games/the_splitting.swf |
10.3 MB |
| Cool.Flash.Games/Games/the_splitting_chapter_2.swf |
37.7 MB |
| Cool.Flash.Games/Games/the_utans_-_defender_of_mavas.swf |
13.2 MB |
| Cool.Flash.Games/Games/the_visit.swf |
8.2 MB |
| Cool.Flash.Games/Games/the_world_s_hardest_game_4.swf |
5.2 MB |
| Cool.Flash.Games/Games/the_worlds_hardest_game.swf |
727 KB |
| Cool.Flash.Games/Games/the_worlds_hardest_game_v_2_0.swf |
2.3 MB |
| Cool.Flash.Games/Games/theadventuresofred.swf |
2.3 MB |
| Cool.Flash.Games/Games/thebullet.swf |
4.5 MB |
| Cool.Flash.Games/Games/thecompanyofmyself.swf |
3.2 MB |
| Cool.Flash.Games/Games/thefirsthero.swf |
5.4 MB |
| Cool.Flash.Games/Games/thegolem.swf |
7.7 MB |
| Cool.Flash.Games/Games/thehuntingofthesnark.swf |
3.8 MB |
| Cool.Flash.Games/Games/thelegendofthegoldenrobot.swf |
4.1 MB |
| Cool.Flash.Games/Games/themagneticcat.swf |
5.3 MB |
| Cool.Flash.Games/Games/themanwiththeinvisibletrousers.swf |
2.7 MB |
| Cool.Flash.Games/Games/themostwantedbandito.swf |
6.8 MB |
| Cool.Flash.Games/Games/themostwantedbandito2.swf |
5 MB |
| Cool.Flash.Games/Games/thepaintgunner.swf |
6.4 MB |
| Cool.Flash.Games/Games/Theropods.swf |
3.5 MB |
| Cool.Flash.Games/Games/thewok.swf |
6.7 MB |
| Cool.Flash.Games/Games/Thing-Thing Series/Thing-Thing Arena 2.swf |
5 MB |
| Cool.Flash.Games/Games/Thing-Thing Series/Thing-Thing Arena 3.swf |
6.4 MB |
| Cool.Flash.Games/Games/Thing-Thing Series/Thing-Thing Arena.swf |
4.5 MB |
| Cool.Flash.Games/Games/Thing-Thing Series/Thing-Thing.swf |
626 KB |
| Cool.Flash.Games/Games/Thing-Thing Series/thing-thing_2.swf |
1.8 MB |
| Cool.Flash.Games/Games/Thing-Thing Series/thing-thing_3.swf |
6.8 MB |
| Cool.Flash.Games/Games/Thing-Thing Series/thing-thing_4.swf |
4.5 MB |
| Cool.Flash.Games/Games/Thing-Thing Series/thing-thing_arena_classic.swf |
12.3 MB |
| Cool.Flash.Games/Games/Thing-Thing Series/thing-thing_arena_pro.swf |
11.8 MB |
| Cool.Flash.Games/Games/third_kingdom.swf |
15.7 MB |
| Cool.Flash.Games/Games/This is not a minimalist game.swf |
4 MB |
| Cool.Flash.Games/Games/Tickets 4Love.swf |
3.3 MB |
| Cool.Flash.Games/Games/Time Swap A Look To The Past.swf |
6.7 MB |
| Cool.Flash.Games/Games/timekiller.swf |
9.1 MB |
| Cool.Flash.Games/Games/Tiny Dangerous Dungeons.swf |
5.6 MB |
| Cool.Flash.Games/Games/Tiny Hawk.swf |
2.4 MB |
| Cool.Flash.Games/Games/tinyking.swf |
8.4 MB |
| Cool.Flash.Games/Games/tinysasters2.swf |
7.8 MB |
| Cool.Flash.Games/Games/tinysquad.swf |
3.8 MB |
| Cool.Flash.Games/Games/Tip of the Tongue.swf |
12.5 MB |
| Cool.Flash.Games/Games/tobesgreatescape.swf |
1.9 MB |
| Cool.Flash.Games/Games/tokyoguineapop.swf |
5.7 MB |
| Cool.Flash.Games/Games/tombdefender.swf |
6.7 MB |
| Cool.Flash.Games/Games/tony robinson`s weird world of wonders.swf |
9.3 MB |
| Cool.Flash.Games/Games/Tooka Laydee.swf |
38.5 MB |
| Cool.Flash.Games/Games/topsyturvy.swf |
1.6 MB |
| Cool.Flash.Games/Games/Toss_the_turtle.swf |
7.4 MB |
| Cool.Flash.Games/Games/Tower of Heaven.swf |
10.9 MB |
| Cool.Flash.Games/Games/Tower of the Archmage.swf |
6.1 MB |
| Cool.Flash.Games/Games/tower_breaker.swf |
2.5 MB |
| Cool.Flash.Games/Games/Town of Fears.swf |
5.2 MB |
| Cool.Flash.Games/Games/Toxers.swf |
8.3 MB |
| Cool.Flash.Games/Games/Trafalgar Origins.swf |
13.2 MB |
| Cool.Flash.Games/Games/transformers_escape.swf |
4.7 MB |
| Cool.Flash.Games/Games/Transmorpher 3.swf |
5.2 MB |
| Cool.Flash.Games/Games/transmorpher.swf |
5.6 MB |
| Cool.Flash.Games/Games/transmorpher2.swf |
9.2 MB |
| Cool.Flash.Games/Games/transylvania.swf |
7.5 MB |
| Cool.Flash.Games/Games/Trapped 2.swf |
3.5 MB |
| Cool.Flash.Games/Games/Trapped.swf |
8.4 MB |
| Cool.Flash.Games/Games/treasure_of_cutlass_reef.swf |
975 KB |
| Cool.Flash.Games/Games/tribot fighter.swf |
13.3 MB |
| Cool.Flash.Games/Games/trophiends.swf |
2.3 MB |
| Cool.Flash.Games/Games/truck_loader_5.swf |
5.3 MB |
| Cool.Flash.Games/Games/truckloader4.swf |
4.7 MB |
| Cool.Flash.Games/Games/Tumble Waiter.swf |
1.3 MB |
| Cool.Flash.Games/Games/turbo kids.swf |
6.4 MB |
| Cool.Flash.Games/Games/Ubooly Friends.swf |
11.2 MB |
| Cool.Flash.Games/Games/Ultimate Crab Battle.swf |
2.9 MB |
| Cool.Flash.Games/Games/Ultimate Gamer Challenge.swf |
7 MB |
| Cool.Flash.Games/Games/undeadend2.swf |
16.6 MB |
| Cool.Flash.Games/Games/Understanding Games Episode 1.swf |
3.1 MB |
| Cool.Flash.Games/Games/Understanding Games Episode 2.swf |
2.3 MB |
| Cool.Flash.Games/Games/Understanding Games Episode 3.swf |
2.1 MB |
| Cool.Flash.Games/Games/Understanding Games Episode 4.swf |
3.4 MB |
| Cool.Flash.Games/Games/unfreezeme.swf |
3.2 MB |
| Cool.Flash.Games/Games/unfreezeme2.swf |
3.3 MB |
| Cool.Flash.Games/Games/unperfect.swf |
1.2 MB |
| Cool.Flash.Games/Games/Up Down Ready.swf |
1.7 MB |
| Cool.Flash.Games/Games/Upgrade Complete 2.swf |
8.1 MB |
| Cool.Flash.Games/Games/Upgrade Complete 3.swf |
7.2 MB |
| Cool.Flash.Games/Games/upgradecomplete.swf |
3.1 MB |
| Cool.Flash.Games/Games/Urbex.swf |
12.8 MB |
| Cool.Flash.Games/Games/Use Boxmen.swf |
4.4 MB |
| Cool.Flash.Games/Games/utopianmining.swf |
12.4 MB |
| Cool.Flash.Games/Games/valthirian-arc.swf |
5.1 MB |
| Cool.Flash.Games/Games/valthirian_arc_2.swf |
19.8 MB |
| Cool.Flash.Games/Games/vampire skills.swf |
9.3 MB |
| Cool.Flash.Games/Games/Vehicles Level Pack.swf |
5.1 MB |
| Cool.Flash.Games/Games/vehicles.swf |
2.9 MB |
| Cool.Flash.Games/Games/vehicles2.swf |
4.5 MB |
| Cool.Flash.Games/Games/vehicles3cartoons.swf |
4.6 MB |
| Cool.Flash.Games/Games/verge.swf |
4 MB |
| Cool.Flash.Games/Games/vertical_drop_heroes.swf |
2.9 MB |
| Cool.Flash.Games/Games/vex.swf |
3.8 MB |
| Cool.Flash.Games/Games/vex3.swf |
7.2 MB |
| Cool.Flash.Games/Games/vex_2.swf |
4.2 MB |
| Cool.Flash.Games/Games/vexation.swf |
4.9 MB |
| Cool.Flash.Games/Games/vexation_2.swf |
4 MB |
| Cool.Flash.Games/Games/vi_defenders.swf |
13.1 MB |
| Cool.Flash.Games/Games/viaductdesigner.swf |
4.3 MB |
| Cool.Flash.Games/Games/viking-valor.swf |
4.3 MB |
| Cool.Flash.Games/Games/Viktor the Nth.swf |
6.4 MB |
| Cool.Flash.Games/Games/vilesteel.swf |
12.4 MB |
| Cool.Flash.Games/Games/villainous.swf |
6.3 MB |
| Cool.Flash.Games/Games/Vision by Proxy 2nd Ed..swf |
7.2 MB |
| Cool.Flash.Games/Games/volcania.swf |
5.9 MB |
| Cool.Flash.Games/Games/Vorago.swf |
9.8 MB |
| Cool.Flash.Games/Games/Vortex Point Series/Vortex Point 3.swf |
7 MB |
| Cool.Flash.Games/Games/Vortex Point Series/Vortex Point 5 - Monster Movie.swf |
11.5 MB |
| Cool.Flash.Games/Games/Vortex Point Series/Vortex Point 6.swf |
10.6 MB |
| Cool.Flash.Games/Games/Vortex Point Series/Vortex Point 7.swf |
12.6 MB |
| Cool.Flash.Games/Games/Vortex Point Series/Vortex Point 8.swf |
6.4 MB |
| Cool.Flash.Games/Games/Vortex Point Series/Vortex Point.swf |
3.4 MB |
| Cool.Flash.Games/Games/Vortex Point Series/vortex_point_2.swf |
4.8 MB |
| Cool.Flash.Games/Games/Vortex Point Series/VortexPoint4.swf |
9.1 MB |
| Cool.Flash.Games/Games/Vox Populi Vox Dei(a werewolf thriller).swf |
230 KB |
| Cool.Flash.Games/Games/Wake Up the Box Series/Wake Up the Box 5.swf |
5.1 MB |
| Cool.Flash.Games/Games/Wake Up the Box Series/wake_up_the_box_4.swf |
1.8 MB |
| Cool.Flash.Games/Games/Wake Up the Box Series/wakeupthebox.swf |
825 KB |
| Cool.Flash.Games/Games/Wake Up the Box Series/wakeupthebox2.swf |
2 MB |
| Cool.Flash.Games/Games/Wake Up the Box Series/wakeupthebox3.swf |
2.6 MB |
| Cool.Flash.Games/Games/war_card.swf |
5.2 MB |
| Cool.Flash.Games/Games/war_zomb_avatar.swf |
12.6 MB |
| Cool.Flash.Games/Games/warface.swf |
3.3 MB |
| Cool.Flash.Games/Games/Warfare 1917.swf |
5.4 MB |
| Cool.Flash.Games/Games/warfare_1944.swf |
8.3 MB |
| Cool.Flash.Games/Games/warlords-2-rise-of-demons.swf |
7.3 MB |
| Cool.Flash.Games/Games/warlordsepicconflict.swf |
13.5 MB |
| Cool.Flash.Games/Games/warpgame.swf |
4.3 MB |
| Cool.Flash.Games/Games/wasabi.swf |
2.1 MB |
| Cool.Flash.Games/Games/Water Werks.swf |
1.2 MB |
| Cool.Flash.Games/Games/wearefriends.swf |
2.5 MB |
| Cool.Flash.Games/Games/werebox.swf |
1004 KB |
| Cool.Flash.Games/Games/westerado.swf |
12.3 MB |
| Cool.Flash.Games/Games/Whack Series/dont_whack_your_boss.swf |
3.4 MB |
| Cool.Flash.Games/Games/Whack Series/dont_whack_your_teacher.swf |
7.7 MB |
| Cool.Flash.Games/Games/Whack Series/whack_the_creeps.swf |
6.7 MB |
| Cool.Flash.Games/Games/Whack Series/whack_the_serial_killer_escape_from_torture.swf |
32.4 MB |
| Cool.Flash.Games/Games/Whack Series/whack_the_terrorist.swf |
8.3 MB |
| Cool.Flash.Games/Games/Whack Series/Whack_The_Thief.swf |
14.6 MB |
| Cool.Flash.Games/Games/Whack Series/whack_your_boss.swf |
1.9 MB |
| Cool.Flash.Games/Games/Whack Series/whack_your_boss_17ways.swf |
3.3 MB |
| Cool.Flash.Games/Games/Whack Series/whack_your_pc.swf |
1.2 MB |
| Cool.Flash.Games/Games/Whack Series/whack_your_soul_mate.swf |
1.6 MB |
| Cool.Flash.Games/Games/Wheely Series/Wheely 2.swf |
8.2 MB |
| Cool.Flash.Games/Games/Wheely Series/Wheely 3.swf |
9.3 MB |
| Cool.Flash.Games/Games/Wheely Series/Wheely 4 Time Travel.swf |
13.1 MB |
| Cool.Flash.Games/Games/Wheely Series/Wheely 5 Armageddon.swf |
14 MB |
| Cool.Flash.Games/Games/Wheely Series/Wheely 6 Fairytale.swf |
11.2 MB |
| Cool.Flash.Games/Games/Wheely Series/Wheely 7 Detective.swf |
15.5 MB |
| Cool.Flash.Games/Games/Wheely Series/Wheely 8 Aliens.swf |
7.1 MB |
| Cool.Flash.Games/Games/Wheely Series/Wheely.swf |
4.7 MB |
| Cool.Flash.Games/Games/wheniwasyoung.swf |
2.2 MB |
| Cool.Flash.Games/Games/Where is series/Where is 2010.swf |
1.2 MB |
| Cool.Flash.Games/Games/Where is series/where_is_2009.swf |
935 KB |
| Cool.Flash.Games/Games/Where is series/where_is_2011.swf |
5.8 MB |
| Cool.Flash.Games/Games/Where is series/where_is_2012.swf |
4 MB |
| Cool.Flash.Games/Games/Where is series/where_is_2013.swf |
9.9 MB |
| Cool.Flash.Games/Games/Where is series/where_is_2014.swf |
1.2 MB |
| Cool.Flash.Games/Games/Where is series/where_is_2015.swf |
27.7 MB |
| Cool.Flash.Games/Games/Where is series/where_is_2016.swf |
16.2 MB |
| Cool.Flash.Games/Games/where`re my bunnies.swf |
1.8 MB |
| Cool.Flash.Games/Games/whereismybeard.swf |
7.8 MB |
| Cool.Flash.Games/Games/whiterandom.swf |
1.5 MB |
| Cool.Flash.Games/Games/Why Am I Dead Rebirth.swf |
2.7 MB |
| Cool.Flash.Games/Games/Why Am I Dead.swf |
3 MB |
| Cool.Flash.Games/Games/wickedrider.swf |
3.5 MB |
| Cool.Flash.Games/Games/William and Sly.swf |
6.1 MB |
| Cool.Flash.Games/Games/william_and_sly_2.swf |
8.7 MB |
| Cool.Flash.Games/Games/william_the_conqueror.swf |
3.7 MB |
| Cool.Flash.Games/Games/Wilt Last Blossom.swf |
9.7 MB |
| Cool.Flash.Games/Games/witchhunt.swf |
14.3 MB |
| Cool.Flash.Games/Games/Wizard's Run.swf |
1.2 MB |
| Cool.Flash.Games/Games/wizardwalls.swf |
5.5 MB |
| Cool.Flash.Games/Games/wolverine_mrd_escape.swf |
4.5 MB |
| Cool.Flash.Games/Games/wolverine_tokyo_fury.swf |
6.1 MB |
| Cool.Flash.Games/Games/wonderputt.swf |
3 MB |
| Cool.Flash.Games/Games/wondrous_lands.swf |
23.2 MB |
| Cool.Flash.Games/Games/workingstiffs.swf |
1.8 MB |
| Cool.Flash.Games/Games/worldofmutants.swf |
5.9 MB |
| Cool.Flash.Games/Games/wormmadness.swf |
2.1 MB |
| Cool.Flash.Games/Games/Wrap_Attack.swf |
5.6 MB |
| Cool.Flash.Games/Games/wrath_of_zombies.swf |
5 MB |
| Cool.Flash.Games/Games/WW2 dogfight age of Warplane.swf |
9.1 MB |
| Cool.Flash.Games/Games/x-ray_detective.swf |
15.2 MB |
| Cool.Flash.Games/Games/xenos.swf |
19.2 MB |
| Cool.Flash.Games/Games/xenosquad.swf |
9.7 MB |
| Cool.Flash.Games/Games/xmastrollcannon.swf |
4.1 MB |
| Cool.Flash.Games/Games/Xonix 3d.swf |
3.6 MB |
| Cool.Flash.Games/Games/xonix3dlevelspack.swf |
4.1 MB |
| Cool.Flash.Games/Games/yellow_puzzle.swf |
3.9 MB |
| Cool.Flash.Games/Games/yo-ho-hocannon.swf |
2 MB |
| Cool.Flash.Games/Games/You Are A Box.swf |
3.8 MB |
| Cool.Flash.Games/Games/You Only Live Once.swf |
5.3 MB |
| Cool.Flash.Games/Games/You're Grounded!.swf |
13.4 MB |
| Cool.Flash.Games/Games/youarestillabox.swf |
4.4 MB |
| Cool.Flash.Games/Games/youda_mystery_-_stanwick.swf |
17.5 MB |
| Cool.Flash.Games/Games/yummynuts.swf |
4.4 MB |
| Cool.Flash.Games/Games/yummynuts2.swf |
5.7 MB |
| Cool.Flash.Games/Games/yves.swf |
6.5 MB |
| Cool.Flash.Games/Games/zabaax.swf |
938 KB |
| Cool.Flash.Games/Games/zipzip secret dimension.swf |
4.4 MB |
| Cool.Flash.Games/Games/Zombie And Juliet.swf |
13.9 MB |
| Cool.Flash.Games/Games/zombie balloon heads 2.swf |
4.2 MB |
| Cool.Flash.Games/Games/zombie balloon heads 3.swf |
3.3 MB |
| Cool.Flash.Games/Games/zombie balloon heads Halloween.swf |
3.5 MB |
| Cool.Flash.Games/Games/zombie balloon heads.swf |
2.6 MB |
| Cool.Flash.Games/Games/Zombie Bites.swf |
729 KB |
| Cool.Flash.Games/Games/Zombie Crypt 2.swf |
1.5 MB |
| Cool.Flash.Games/Games/Zombie Crypt 3.swf |
1.5 MB |
| Cool.Flash.Games/Games/Zombie Crypt.swf |
1.1 MB |
| Cool.Flash.Games/Games/Zombie Invaders.swf |
1.8 MB |
| Cool.Flash.Games/Games/Zombie Survival - Outbreak.swf |
4.4 MB |
| Cool.Flash.Games/Games/Zombie Survival.swf |
2.6 MB |
| Cool.Flash.Games/Games/Zombie Typocalypse.swf |
5.7 MB |
| Cool.Flash.Games/Games/zombie_at_the_gates.swf |
4.5 MB |
| Cool.Flash.Games/Games/zombie_crusade.swf |
14.3 MB |
| Cool.Flash.Games/Games/zombie_crypt.swf |
1.2 MB |
| Cool.Flash.Games/Games/Zombie_Fight_Club.swf |
6.3 MB |
| Cool.Flash.Games/Games/zombie_incursion.swf |
4.8 MB |
| Cool.Flash.Games/Games/zombie_land.swf |
1.6 MB |
| Cool.Flash.Games/Games/zombie_madness_-_the_awakening.swf |
6.1 MB |
| Cool.Flash.Games/Games/zombie_pinball.swf |
4.6 MB |
| Cool.Flash.Games/Games/zombie_tactics.swf |
3.6 MB |
| Cool.Flash.Games/Games/zombie_trailer_park.swf |
4.4 MB |
| Cool.Flash.Games/Games/zombie_train.swf |
4.6 MB |
| Cool.Flash.Games/Games/Zombie_World_Game.swf |
10.7 MB |
| Cool.Flash.Games/Games/zombiecats.swf |
9.1 MB |
| Cool.Flash.Games/Games/zombiedemolisher.swf |
10.1 MB |
| Cool.Flash.Games/Games/zombieknight.swf |
2.5 MB |
| Cool.Flash.Games/Games/zombieoutbreak2.swf |
8.9 MB |
| Cool.Flash.Games/Games/zombierumble.swf |
2 MB |
| Cool.Flash.Games/Games/Zombies in the shadow act 1.swf |
9.4 MB |
| Cool.Flash.Games/Games/zombies in the shadow the saviour act 2.swf |
10 MB |
| Cool.Flash.Games/Games/zombies_inc.swf |
3.5 MB |
| Cool.Flash.Games/Games/zombies_took_my_daughter.swf |
2.5 MB |
| Cool.Flash.Games/Games/zombies_vs_penguins.swf |
3.8 MB |
| Cool.Flash.Games/Games/zombiesatemyphone.swf |
7.2 MB |
| Cool.Flash.Games/Games/zombiesincentralpark.swf |
5.7 MB |
| Cool.Flash.Games/Games/zombiesintheshadow.swf |
9.1 MB |
| Cool.Flash.Games/Games/zombiesintheshadow20todie.swf |
7.5 MB |
| Cool.Flash.Games/Games/zombiesinyourbackyard.swf |
3.4 MB |
| Cool.Flash.Games/Games/zombiesituation.swf |
4.6 MB |
| Cool.Flash.Games/Games/zombiesmasher.swf |
3 MB |
| Cool.Flash.Games/Games/zombietank.swf |
7.6 MB |
| Cool.Flash.Games/Games/Zombiewest_There_and_Back_Again.swf |
3.6 MB |
| Cool.Flash.Games/Games/Zombinsanity.swf |
9.8 MB |
| Cool.Flash.Games/Games/zomblast.swf |
5.1 MB |
| Cool.Flash.Games/Games/zombobuster.swf |
8.2 MB |
| Cool.Flash.Games/Games/zombobusterrising.swf |
8.4 MB |
| Cool.Flash.Games/Games/zombocalypse.swf |
5.6 MB |
| Cool.Flash.Games/Games/zombocalypse_2.swf |
21.5 MB |
| Cool.Flash.Games/Games/Zombotron 2 Time Machine.swf |
11.7 MB |
| Cool.Flash.Games/Games/Zombotron 2.swf |
11.5 MB |
| Cool.Flash.Games/Games/zombotron.swf |
8.7 MB |
| Cool.Flash.Games/Games/zombudoy 2 the holiday.swf |
6.6 MB |
| Cool.Flash.Games/Games/zombudoy.swf |
8 MB |
| Cool.Flash.Games/Games/zombudoy_3_pirates.swf |
8.9 MB |
| Cool.Flash.Games/Games/Zombus.swf |
8.5 MB |
| Cool.Flash.Games/Games/zomgies.swf |
3.5 MB |
| Cool.Flash.Games/Games/zomgies2.swf |
6.7 MB |
| Cool.Flash.Games/Games/zoo escape 2.swf |
3 MB |
| Cool.Flash.Games/Games/zoo escape.swf |
2.8 MB |
| Cool.Flash.Games/Games/zos.swf |
14.2 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/Dead Detective vs Nine Deaths Cat.swf |
6.6 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/Zombie Society - Dead Detective.swf |
6.9 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/Zombie Society - Death after death 13.swf |
12.5 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/ZS Dead Detective - A cat's chance in hell.swf |
7.3 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/ZS Dead Detective - A Curse In Disguise.swf |
6.7 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/ZS Dead Detective - Brain Drain.swf |
5.8 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/ZS Dead Detective - Graves Secrets.swf |
5.5 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/ZS Dead Detective - Murder Case.swf |
5.8 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/ZS Dead Detective - Rats in a hole.swf |
7 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/ZS Dead Detective - Roving Eyes.swf |
5.9 MB |
| Cool.Flash.Games/Games/ZS Dead Detective Series/ZS Dead Detective - Walls can Bleed.swf |
4.9 MB |
| Cool.Flash.Games/Player/flashplayer_32_sa.exe |
14.7 MB |